Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|07150
Gene name
Locationscaffold_09:753329..757456
Strand-
Gene length (bp)4127
Transcript length (bp)3852
Coding sequence length (bp)3852
Protein length (aa) 1284

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF18947 HAMP_2 HAMP domain 3.2E-07 251 313
PF18947 HAMP_2 HAMP domain 8.3E-08 342 406
PF18947 HAMP_2 HAMP domain 3.4E-09 435 496
PF18947 HAMP_2 HAMP domain 4.6E-07 526 586
PF00672 HAMP HAMP domain 5.0E-08 264 314
PF00672 HAMP HAMP domain 8.2E-06 356 407
PF00672 HAMP HAMP domain 2.6E-08 448 497
PF00672 HAMP HAMP domain 2.5E-06 541 590
PF00672 HAMP HAMP domain 4.4E-03 649 683
PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 5.0E-30 813 929
PF00072 Response_reg Response regulator receiver domain 1.7E-25 1082 1196
PF00512 HisKA His Kinase A (phospho-acceptor) domain 1.7E-16 702 765

GO

GO Term Description Terminal node
GO:0007165 signal transduction Yes
GO:0000155 phosphorelay sensor kinase activity Yes
GO:0000160 phosphorelay signal transduction system Yes
GO:0016021 integral component of membrane Yes
GO:0016301 kinase activity No
GO:0050794 regulation of cellular process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0110165 cellular anatomical entity No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0009987 cellular process No
GO:0050789 regulation of biological process No
GO:0016740 transferase activity No
GO:0031224 intrinsic component of membrane No
GO:0140096 catalytic activity, acting on a protein No
GO:0016775 phosphotransferase activity, nitrogenous group as acceptor No
GO:0008150 biological_process No
GO:0140299 small molecule sensor activity No
GO:0003824 catalytic activity No
GO:0004673 protein histidine kinase activity No
GO:0004672 protein kinase activity No
GO:0035556 intracellular signal transduction No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0065007 biological regulation No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear localization signal 0.6748 0.3652 0.088 0.3246 0.1417 0.1201 0.0766 0.216 0.0883 0.0306

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup664
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3551
Ophiocordyceps australis map64 (Brazil) OphauB2|1705
Ophiocordyceps camponoti-floridani Ophcf2|07150 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3437
Ophiocordyceps kimflemingae Ophio5|2280
Ophiocordyceps subramaniannii Hirsu2|1083

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|07150
MVDDSAMAAAAEVVASLAADQPSSSSLAVGLGSPVKLPGRDTPAKRIFEMELQKLALRIGQLENRASASAPAILP
ETPSEVNDSLFGHENGHARSAPCKPRLSQAHQALEGLREHVDDQSKLLDSQRRELAGVNAQLLEQKELQERALEV
LEQERVATLERELWKHQKANEAFQKALREIGEIVTAVARGDLTMKVRMNTVEMDPEITTFKRTINAMMDQLQIFA
SEVSRVAREVGTEGLLGGQARIGGVDGTWKELTDNVNVMAQNLTDQVREIASVTTAVAHGDLTKKIERPARGEIL
QLQQTINTMVDQLRTFASEVTRVARDVGTEGMLGGQADVGGVQGMWNDLTVNVNAMANNLTTQVRDIIKVTTAVA
KGDLTQKVQADCRGEIFELKSTINSMVDQLQQFAREVTKIAREVGTEGRLGGQATVHDVEGTWRDLTENVNGMAM
NLTTQVREIAKVTTAVAKGDLTKKIGVEVKGEILELKNTINQMVDRLGTFAVEVSKVAREVGTEGTLGGQAQVAN
VEGKWKDLTENVNTMASNLTVQVRSISAVTQAIANGDMSQTIDVEANGEIQVLKETINNMVGRLSSFCYEVQRVA
KDVGVDGKMGAQADIAGLDGRWKEITTDVNTMASNLTTQVRAFSDITNLATDGDFTKLVDVEASGEMDELKRKIN
QMISNLRDSIQRNTQAREAAELANKTKSEFLANMSHEIRTPMNGIIGMTQLTLDTDLTQYQREMLNIVNNLANSL
LTIIDDILDLSKIEARRMVIEEIPYTLRGTVFNALKTLAVKANEKFLDLTYKVDSSVPDHVIGDSFRLRQIILNL
VGNAIKFTEHGEVSLTIKEWTDQDDVRLGEYAVEFVVEDTGIGIAQDKLNLIFDTFQQADGSMTRKFGGTGLGLS
ISKRLVNLMGGDLWVNSESGKGSQFHFTCRVKLATGDTEAIKKQLHPYLGHQVLFVDKAQSSSGPDIRAMLEQIG
LQPVVVDSEMSSALARVKAGGALPYDAILVDTIDTARRLRAVDDFKYLPIVLLAPVVHVSLKSCLDLGITSYMTT
PCKLIDLGNGMIPALENRATPSLADNTRSFEILLAEDNTVNQRLAVKILEKYHHVVTVVSNGWEAVEAVKAKKFD
VILMDVQMPIMGGFEATGKIREYERSVGTHRTPIIALTAHAMMGDREKCIQAQMDEYLSKPLQQNHLIQTILKCA
TLGGPLLERNRERELAIQTDAKSSSHNRNTQGFLRPGLEGRAFTSREPLTGAGLASPTLVTADQEDPWARARRDL
SDIRSISG*
Coding >Ophcf2|07150
ATGGTTGACGACTCTGCCATGGCCGCGGCCGCCGAGGTCGTGGCTTCGCTCGCGGCCGATCAGCCGTCCTCGTCG
TCGCTGGCCGTCGGCCTCGGCTCTCCCGTCAAGCTTCCAGGCCGCGACACGCCCGCAAAGAGGATATTCGAGATG
GAGCTGCAAAAACTCGCCTTACGCATCGGTCAGCTCGAGAACAGGGCCTCGGCCTCGGCTCCAGCCATCCTACCC
GAGACGCCCAGCGAGGTTAACGACTCTCTCTTCGGCCACGAGAATGGCCACGCCCGGTCTGCCCCCTGCAAGCCT
AGGCTGTCTCAAGCTCACCAAGCCCTGGAAGGTCTTCGCGAGCATGTCGACGACCAGTCCAAGCTTCTCGATAGC
CAGCGCCGAGAGCTCGCTGGCGTCAACGCCCAGCTTCTCGAACAGAAGGAGTTACAGGAACGCGCCCTCGAAGTG
CTCGAACAAGAACGAGTCGCCACGCTCGAGAGAGAGCTATGGAAGCATCAAAAGGCCAACGAGGCTTTTCAAAAG
GCCCTTCGCGAAATCGGCGAGATCGTCACCGCCGTCGCCCGAGGTGACTTGACCATGAAGGTCCGCATGAATACT
GTTGAGATGGACCCCGAAATCACGACTTTCAAGCGCACCATCAACGCCATGATGGACCAGCTGCAGATCTTCGCC
AGTGAAGTCTCCAGGGTCGCCCGCGAGGTCGGTACCGAGGGTCTCCTCGGCGGTCAGGCCCGCATCGGTGGCGTC
GACGGTACTTGGAAGGAACTTACGGACAATGTAAACGTCATGGCTCAGAACCTCACTGACCAAGTGCGCGAGATT
GCATCCGTCACCACCGCCGTCGCCCACGGCGATTTGACCAAGAAGATCGAGAGGCCGGCCCGAGGCGAGATCCTG
CAACTGCAACAGACGATAAACACAATGGTCGACCAGCTGCGGACCTTTGCCTCCGAGGTGACGCGCGTCGCGAGA
GACGTCGGCACCGAGGGCATGCTCGGCGGCCAGGCTGACGTCGGCGGAGTGCAGGGCATGTGGAACGACCTGACC
GTCAACGTCAACGCCATGGCAAATAATCTGACGACCCAGGTGCGCGACATCATCAAGGTTACGACGGCCGTCGCC
AAGGGGGACCTCACCCAAAAGGTCCAGGCCGACTGCCGGGGAGAGATATTCGAGCTCAAGTCGACAATCAACTCC
ATGGTGGACCAGCTGCAGCAGTTCGCCCGCGAGGTCACCAAGATCGCCCGCGAGGTCGGCACCGAAGGCCGTCTC
GGCGGCCAGGCCACCGTCCACGATGTTGAGGGCACCTGGAGGGACCTGACGGAAAACGTCAACGGCATGGCCATG
AACCTGACCACGCAGGTGCGGGAGATTGCCAAGGTCACGACAGCCGTGGCCAAGGGCGACCTCACTAAGAAGATC
GGCGTCGAGGTCAAGGGCGAGATCTTGGAGCTCAAGAACACCATCAACCAGATGGTCGACCGCCTCGGCACCTTT
GCCGTCGAGGTCAGCAAGGTGGCCCGCGAGGTCGGCACCGAGGGCACCCTGGGTGGACAGGCGCAGGTCGCAAAC
GTCGAGGGCAAGTGGAAGGACCTGACGGAAAACGTAAACACCATGGCGTCCAACCTTACGGTCCAGGTACGGAGC
ATCTCGGCCGTCACCCAGGCCATCGCCAACGGCGACATGAGCCAGACCATCGACGTCGAGGCAAATGGCGAGATT
CAGGTTCTCAAGGAGACGATCAATAACATGGTTGGCCGACTGTCGAGCTTCTGTTACGAGGTTCAGAGGGTCGCC
AAGGATGTGGGTGTGGACGGTAAGATGGGCGCGCAGGCCGACATAGCCGGCCTCGACGGTCGGTGGAAAGAGATC
ACCACCGACGTCAACACCATGGCCAGCAATCTGACGACGCAAGTGCGGGCCTTTTCTGACATTACGAACCTGGCC
ACCGACGGTGACTTCACCAAGCTCGTCGACGTCGAGGCCTCGGGCGAAATGGACGAGCTCAAGCGAAAGATTAAC
CAGATGATCTCCAACCTGAGGGATAGCATTCAAAGGAACACGCAGGCCAGAGAAGCGGCCGAGCTGGCCAACAAG
ACCAAGTCGGAGTTCCTCGCAAACATGTCGCACGAGATCCGGACGCCGATGAACGGAATCATCGGCATGACGCAG
CTGACGCTCGACACGGACCTCACGCAGTATCAGCGTGAGATGCTAAACATCGTCAACAACCTGGCCAACAGCCTA
CTGACCATCATCGACGACATCTTGGACCTGTCCAAGATTGAGGCCCGGCGGATGGTGATTGAGGAGATTCCGTAC
ACGCTGCGCGGGACCGTCTTCAACGCGCTCAAGACGCTGGCCGTCAAGGCCAACGAGAAGTTCCTCGATCTCACC
TACAAGGTGGACAGCTCGGTGCCCGACCACGTCATCGGCGACTCGTTCCGTCTCCGGCAGATCATTCTCAATCTC
GTCGGCAACGCCATCAAGTTCACCGAGCACGGCGAGGTCAGCCTCACCATCAAGGAGTGGACCGACCAGGATGAC
GTGCGTCTCGGCGAGTACGCCGTCGAGTTCGTCGTCGAGGACACGGGCATCGGTATCGCGCAGGACAAGCTCAAT
CTCATCTTCGACACCTTCCAGCAAGCCGACGGCTCCATGACGCGCAAATTTGGCGGCACCGGCCTCGGCCTGTCC
ATCTCCAAGCGGCTCGTCAACCTCATGGGCGGCGATCTCTGGGTCAACAGCGAGTCCGGCAAGGGCAGCCAATTC
CACTTCACCTGTCGGGTGAAGCTCGCTACGGGAGACACCGAGGCCATCAAGAAGCAGCTCCACCCATACCTGGGC
CACCAGGTTCTCTTCGTCGACAAGGCCCAGTCCAGCTCCGGCCCCGACATCCGGGCGATGCTGGAGCAAATCGGC
CTCCAGCCCGTAGTCGTCGACTCGGAAATGAGCTCGGCCCTGGCCCGGGTCAAGGCCGGAGGCGCGCTGCCCTAC
GACGCCATCCTGGTCGACACCATCGACACGGCCCGCAGGCTAAGGGCCGTCGACGACTTCAAGTATCTACCCATC
GTCCTCTTGGCGCCCGTGGTCCACGTCAGCCTCAAGTCATGTCTTGACCTGGGCATCACGTCATATATGACTACG
CCCTGCAAGCTCATTGACCTCGGCAACGGCATGATTCCCGCGCTCGAGAACAGGGCGACGCCGTCCCTCGCCGAT
AACACCAGATCTTTTGAGATTCTCCTGGCCGAAGACAACACGGTGAACCAACGGCTCGCGGTCAAGATTCTGGAA
AAGTACCACCACGTCGTCACCGTCGTTAGCAACGGGTGGGAGGCGGTCGAGGCGGTCAAGGCGAAGAAGTTTGAC
GTCATCCTGATGGACGTGCAGATGCCAATCATGGGAGGATTCGAGGCCACGGGCAAGATCCGTGAGTACGAGAGG
AGCGTGGGCACGCACCGGACACCCATCATCGCCTTGACGGCTCACGCCATGATGGGCGATCGGGAGAAGTGCATA
CAGGCCCAGATGGATGAGTACCTGTCGAAACCTCTGCAGCAGAATCACCTCATACAGACGATCCTCAAGTGCGCC
ACGCTCGGCGGCCCGCTGCTCGAAAGGAACCGCGAGCGAGAGCTGGCGATACAGACGGACGCCAAGTCGTCAAGC
CACAACCGCAACACGCAGGGCTTCCTACGACCGGGCCTCGAGGGTCGGGCCTTTACCAGCAGAGAACCGCTGACG
GGAGCGGGCCTGGCCAGCCCGACTCTCGTGACGGCGGATCAGGAGGATCCCTGGGCAAGAGCACGTCGTGATCTA
TCCGACATCCGGAGCATCTCTGGCTAA
Transcript >Ophcf2|07150
ATGGTTGACGACTCTGCCATGGCCGCGGCCGCCGAGGTCGTGGCTTCGCTCGCGGCCGATCAGCCGTCCTCGTCG
TCGCTGGCCGTCGGCCTCGGCTCTCCCGTCAAGCTTCCAGGCCGCGACACGCCCGCAAAGAGGATATTCGAGATG
GAGCTGCAAAAACTCGCCTTACGCATCGGTCAGCTCGAGAACAGGGCCTCGGCCTCGGCTCCAGCCATCCTACCC
GAGACGCCCAGCGAGGTTAACGACTCTCTCTTCGGCCACGAGAATGGCCACGCCCGGTCTGCCCCCTGCAAGCCT
AGGCTGTCTCAAGCTCACCAAGCCCTGGAAGGTCTTCGCGAGCATGTCGACGACCAGTCCAAGCTTCTCGATAGC
CAGCGCCGAGAGCTCGCTGGCGTCAACGCCCAGCTTCTCGAACAGAAGGAGTTACAGGAACGCGCCCTCGAAGTG
CTCGAACAAGAACGAGTCGCCACGCTCGAGAGAGAGCTATGGAAGCATCAAAAGGCCAACGAGGCTTTTCAAAAG
GCCCTTCGCGAAATCGGCGAGATCGTCACCGCCGTCGCCCGAGGTGACTTGACCATGAAGGTCCGCATGAATACT
GTTGAGATGGACCCCGAAATCACGACTTTCAAGCGCACCATCAACGCCATGATGGACCAGCTGCAGATCTTCGCC
AGTGAAGTCTCCAGGGTCGCCCGCGAGGTCGGTACCGAGGGTCTCCTCGGCGGTCAGGCCCGCATCGGTGGCGTC
GACGGTACTTGGAAGGAACTTACGGACAATGTAAACGTCATGGCTCAGAACCTCACTGACCAAGTGCGCGAGATT
GCATCCGTCACCACCGCCGTCGCCCACGGCGATTTGACCAAGAAGATCGAGAGGCCGGCCCGAGGCGAGATCCTG
CAACTGCAACAGACGATAAACACAATGGTCGACCAGCTGCGGACCTTTGCCTCCGAGGTGACGCGCGTCGCGAGA
GACGTCGGCACCGAGGGCATGCTCGGCGGCCAGGCTGACGTCGGCGGAGTGCAGGGCATGTGGAACGACCTGACC
GTCAACGTCAACGCCATGGCAAATAATCTGACGACCCAGGTGCGCGACATCATCAAGGTTACGACGGCCGTCGCC
AAGGGGGACCTCACCCAAAAGGTCCAGGCCGACTGCCGGGGAGAGATATTCGAGCTCAAGTCGACAATCAACTCC
ATGGTGGACCAGCTGCAGCAGTTCGCCCGCGAGGTCACCAAGATCGCCCGCGAGGTCGGCACCGAAGGCCGTCTC
GGCGGCCAGGCCACCGTCCACGATGTTGAGGGCACCTGGAGGGACCTGACGGAAAACGTCAACGGCATGGCCATG
AACCTGACCACGCAGGTGCGGGAGATTGCCAAGGTCACGACAGCCGTGGCCAAGGGCGACCTCACTAAGAAGATC
GGCGTCGAGGTCAAGGGCGAGATCTTGGAGCTCAAGAACACCATCAACCAGATGGTCGACCGCCTCGGCACCTTT
GCCGTCGAGGTCAGCAAGGTGGCCCGCGAGGTCGGCACCGAGGGCACCCTGGGTGGACAGGCGCAGGTCGCAAAC
GTCGAGGGCAAGTGGAAGGACCTGACGGAAAACGTAAACACCATGGCGTCCAACCTTACGGTCCAGGTACGGAGC
ATCTCGGCCGTCACCCAGGCCATCGCCAACGGCGACATGAGCCAGACCATCGACGTCGAGGCAAATGGCGAGATT
CAGGTTCTCAAGGAGACGATCAATAACATGGTTGGCCGACTGTCGAGCTTCTGTTACGAGGTTCAGAGGGTCGCC
AAGGATGTGGGTGTGGACGGTAAGATGGGCGCGCAGGCCGACATAGCCGGCCTCGACGGTCGGTGGAAAGAGATC
ACCACCGACGTCAACACCATGGCCAGCAATCTGACGACGCAAGTGCGGGCCTTTTCTGACATTACGAACCTGGCC
ACCGACGGTGACTTCACCAAGCTCGTCGACGTCGAGGCCTCGGGCGAAATGGACGAGCTCAAGCGAAAGATTAAC
CAGATGATCTCCAACCTGAGGGATAGCATTCAAAGGAACACGCAGGCCAGAGAAGCGGCCGAGCTGGCCAACAAG
ACCAAGTCGGAGTTCCTCGCAAACATGTCGCACGAGATCCGGACGCCGATGAACGGAATCATCGGCATGACGCAG
CTGACGCTCGACACGGACCTCACGCAGTATCAGCGTGAGATGCTAAACATCGTCAACAACCTGGCCAACAGCCTA
CTGACCATCATCGACGACATCTTGGACCTGTCCAAGATTGAGGCCCGGCGGATGGTGATTGAGGAGATTCCGTAC
ACGCTGCGCGGGACCGTCTTCAACGCGCTCAAGACGCTGGCCGTCAAGGCCAACGAGAAGTTCCTCGATCTCACC
TACAAGGTGGACAGCTCGGTGCCCGACCACGTCATCGGCGACTCGTTCCGTCTCCGGCAGATCATTCTCAATCTC
GTCGGCAACGCCATCAAGTTCACCGAGCACGGCGAGGTCAGCCTCACCATCAAGGAGTGGACCGACCAGGATGAC
GTGCGTCTCGGCGAGTACGCCGTCGAGTTCGTCGTCGAGGACACGGGCATCGGTATCGCGCAGGACAAGCTCAAT
CTCATCTTCGACACCTTCCAGCAAGCCGACGGCTCCATGACGCGCAAATTTGGCGGCACCGGCCTCGGCCTGTCC
ATCTCCAAGCGGCTCGTCAACCTCATGGGCGGCGATCTCTGGGTCAACAGCGAGTCCGGCAAGGGCAGCCAATTC
CACTTCACCTGTCGGGTGAAGCTCGCTACGGGAGACACCGAGGCCATCAAGAAGCAGCTCCACCCATACCTGGGC
CACCAGGTTCTCTTCGTCGACAAGGCCCAGTCCAGCTCCGGCCCCGACATCCGGGCGATGCTGGAGCAAATCGGC
CTCCAGCCCGTAGTCGTCGACTCGGAAATGAGCTCGGCCCTGGCCCGGGTCAAGGCCGGAGGCGCGCTGCCCTAC
GACGCCATCCTGGTCGACACCATCGACACGGCCCGCAGGCTAAGGGCCGTCGACGACTTCAAGTATCTACCCATC
GTCCTCTTGGCGCCCGTGGTCCACGTCAGCCTCAAGTCATGTCTTGACCTGGGCATCACGTCATATATGACTACG
CCCTGCAAGCTCATTGACCTCGGCAACGGCATGATTCCCGCGCTCGAGAACAGGGCGACGCCGTCCCTCGCCGAT
AACACCAGATCTTTTGAGATTCTCCTGGCCGAAGACAACACGGTGAACCAACGGCTCGCGGTCAAGATTCTGGAA
AAGTACCACCACGTCGTCACCGTCGTTAGCAACGGGTGGGAGGCGGTCGAGGCGGTCAAGGCGAAGAAGTTTGAC
GTCATCCTGATGGACGTGCAGATGCCAATCATGGGAGGATTCGAGGCCACGGGCAAGATCCGTGAGTACGAGAGG
AGCGTGGGCACGCACCGGACACCCATCATCGCCTTGACGGCTCACGCCATGATGGGCGATCGGGAGAAGTGCATA
CAGGCCCAGATGGATGAGTACCTGTCGAAACCTCTGCAGCAGAATCACCTCATACAGACGATCCTCAAGTGCGCC
ACGCTCGGCGGCCCGCTGCTCGAAAGGAACCGCGAGCGAGAGCTGGCGATACAGACGGACGCCAAGTCGTCAAGC
CACAACCGCAACACGCAGGGCTTCCTACGACCGGGCCTCGAGGGTCGGGCCTTTACCAGCAGAGAACCGCTGACG
GGAGCGGGCCTGGCCAGCCCGACTCTCGTGACGGCGGATCAGGAGGATCCCTGGGCAAGAGCACGTCGTGATCTA
TCCGACATCCGGAGCATCTCTGGCTAA
Gene >Ophcf2|07150
ATGGTTGACGACTCTGCCATGGCCGCGGCCGCCGAGGTCGTGGCTTCGCTCGCGGCCGATCAGCCGTCCTCGTCG
TCGCTGGCCGTCGGCCTCGGCTCTCCCGTCAAGCTTCCAGGCCGCGACACGCCCGCAAAGAGGATATTCGAGATG
GAGCTGCAAAAACTCGCCTTACGCATCGGTCAGCTCGAGAACAGGGCCTCGGCCTCGGCTCCAGCCATCCTACCC
GAGACGCCCAGCGAGGTTAACGACTCTCTCTTCGGCCACGAGAATGGCCACGCCCGGTCTGCCCCCTGCAAGCCT
AGGCTGTCTCAAGCTCACCAAGGTAGCTCTGCCGTCCCGCGCTCCCCTTCCCGTGTCTCGCCAGCTGAATCCCAA
GCAGCCCTGGAAGGTCTTCGCGAGCATGTCGACGACCAGTCCAAGCTTCTCGATAGCCAGCGCCGAGAGCTCGCT
GGCGTCAACGCCCAGCTTCTCGAACAGAAGGAGTTACAGGAACGCGCCCTCGAAGTGCTCGAACAAGAACGAGTC
GCCACGCTCGAGAGAGAGCTATGGAAGCATCAAAAGGCCAACGAGGCTTTTCAAAAGGCCCTTCGCGAAATCGGC
GAGATCGTCACCGCCGTCGCCCGAGGTGACTTGACCATGAAGGTCCGCATGAATACTGTTGAGATGGACCCCGAA
ATCACGACTTTCAAGCGCACCATCAACGCCATGATGGACCAGCTGCAGATCTTCGCCAGTGAAGTCTCCAGGGTC
GCCCGCGAGGTCGGTACCGAGGGTCTCCTCGGCGGTCAGGCCCGCATCGGTGGCGTCGACGGTACTTGGAAGGAA
CTTACGGACAATGGTACCGTCCCCCGTCTGCCCGGCTCGATGCTCACGTTCGCGCTGACTGGTCTTGCAGTAAAC
GTCATGGCTCAGAACCTCACTGACCAAGGTAAGTTGACATATTTCCTTCCTTTCTGTCCCATCTGACGTGTACGG
CAGTGCGCGAGATTGCATCCGTCACCACCGCCGTCGCCCACGGCGATTTGACCAAGAAGATCGAGAGGCCGGCCC
GAGGCGAGATCCTGCAACTGCAACAGACGATAAACACAATGGTCGACCAGCTGCGGACCTTTGCCTCCGAGGTGA
CGCGCGTCGCGAGAGACGTCGGCACCGAGGGCATGCTCGGCGGCCAGGCTGACGTCGGCGGAGTGCAGGGCATGT
GGAACGACCTGACCGTCAACGTCAACGCCATGGCAAATAATCTGACGACCCAGGTGCGCGACATCATCAAGGTTA
CGACGGCCGTCGCCAAGGGGGACCTCACCCAAAAGGTCCAGGCCGACTGCCGGGGAGAGATATTCGAGCTCAAGT
CGACAATCAACTCCATGGTGGACCAGCTGCAGCAGTTCGCCCGCGAGGTCACCAAGATCGCCCGCGAGGTCGGCA
CCGAAGGCCGTCTCGGCGGCCAGGCCACCGTCCACGATGTTGAGGGCACCTGGAGGGACCTGACGGAAAACGTCA
ACGGCATGGCCATGAACCTGACCACGCAGGTGCGGGAGATTGCCAAGGTCACGACAGCCGTGGCCAAGGGCGACC
TCACTAAGAAGATCGGCGTCGAGGTCAAGGGCGAGATCTTGGAGCTCAAGAACACCATCAACCAGATGGTCGACC
GCCTCGGCACCTTTGCCGTCGAGGTCAGCAAGGTGGCCCGCGAGGTCGGCACCGAGGGCACCCTGGGTGGACAGG
CGCAGGTCGCAAACGTCGAGGGCAAGTGGAAGGACCTGACGGAAAACGTAAACACCATGGCGTCCAACCTTACGG
TCCAGGTACGGAGCATCTCGGCCGTCACCCAGGCCATCGCCAACGGCGACATGAGCCAGACCATCGACGTCGAGG
CAAATGGCGAGATTCAGGTTCTCAAGGAGACGATCAATAACATGGTTGGCCGACTGTCGAGCTTCTGTTACGAGG
TTCAGAGGGTCGCCAAGGATGTGGGTGTGGACGGTAAGATGGGCGCGCAGGCCGACATAGCCGGCCTCGACGGTC
GGTGGAAAGAGATCACCACCGACGTCAACACCATGGCCAGCAATCTGGTGAGTCACCGAGGAGGAGGAGGCTTTC
GAGGGGGCAAGCTAGCTGACGCCAGCGCAGACGACGCAAGTGCGGGCCTTTTCTGACATTACGAACCTGGCCACC
GACGGTGACTTCACCAAGCTCGTCGACGTCGAGGCCTCGGGCGAAATGGACGAGCTCAAGCGAAAGATTAACCAG
ATGATCTCCAACCTGAGGGATAGCATTCAAAGGAACACGCAGGCCAGAGAAGCGGCCGAGCTGGCCAACAAGACC
AAGTCGGAGTTCCTCGCAAACATGTCGCACGAGATCCGGACGCCGATGAACGGAATCATCGGCATGACGCAGCTG
ACGCTCGACACGGACCTCACGCAGTATCAGCGTGAGATGCTAAACATCGTCAACAACCTGGCCAACAGCCTACTG
ACCATCATCGACGACATCTTGGACCTGTCCAAGATTGAGGCCCGGCGGATGGTGATTGAGGAGATTCCGTACACG
CTGCGCGGGACCGTCTTCAACGCGCTCAAGACGCTGGCCGTCAAGGCCAACGAGAAGTTCCTCGATCTCACCTAC
AAGGTGGACAGCTCGGTGCCCGACCACGTCATCGGCGACTCGTTCCGTCTCCGGCAGATCATTCTCAATCTCGTC
GGCAACGCCATCAAGTTCACCGAGCACGGCGAGGTCAGCCTCACCATCAAGGAGTGGACCGACCAGGATGACGTG
CGTCTCGGCGAGTACGCCGTCGAGTTCGTCGTCGAGGACACGGGCATCGGTATCGCGCAGGACAAGCTCAATCTC
ATCTTCGACACCTTCCAGCAAGCCGACGGCTCCATGACGCGCAAATTTGGCGGCACCGGCCTCGGCCTGTCCATC
TCCAAGCGGCTCGTCAACCTCATGGGCGGCGATCTCTGGGTCAACAGCGAGTCCGGCAAGGGCAGCCAATTCCAC
TTCACCTGTCGGGTGAAGCTCGCTACGGGAGACACCGAGGCCATCAAGAAGCAGCTCCACCCATACCTGGGCCAC
CAGGTTCTCTTCGTCGACAAGGCCCAGTCCAGCTCCGGCCCCGACATCCGGGCGATGCTGGAGCAAATCGGCCTC
CAGCCCGTAGTCGTCGACTCGGAAATGAGCTCGGCCCTGGCCCGGGTCAAGGCCGGAGGCGCGCTGCCCTACGAC
GCCATCCTGGTCGACACCATCGACACGGCCCGCAGGCTAAGGGCCGTCGACGACTTCAAGTATCTACCCATCGTC
CTCTTGGCGCCCGTGGTCCACGTCAGCCTCAAGTCATGTCTTGACCTGGGCATCACGTCATATATGACTACGCCC
TGCAAGCTCATTGACCTCGGCAACGGCATGATTCCCGCGCTCGAGAACAGGGCGACGCCGTCCCTCGCCGATAAC
ACCAGATCTTTTGAGATTCTCCTGGCCGAAGACAACACGGTGAACCAACGGCTCGCGGTCAAGATTCTGGAAAAG
TACCACCACGTCGTCACCGTCGTTAGCAACGGGTGGGAGGCGGTCGAGGCGGTCAAGGCGAAGAAGTTTGACGTC
ATCCTGATGGACGTGCAGATGCCAATCATGGTGAGTCGGGTGGAAGGTCGGGTCCAAGTCGTGTGATACTGACGG
CATCGCAGGGAGGATTCGAGGCCACGGGCAAGATCCGTGAGTACGAGAGGAGCGTGGGCACGCACCGGACACCCA
TCATCGCCTTGACGGCTCACGCCATGATGGGCGATCGGGAGAAGTGCATACAGGCCCAGATGGATGAGTACCTGT
CGAAACCTCTGCAGCAGAATCACCTCATACAGACGATCCTCAAGTGCGCCACGCTCGGCGGCCCGCTGCTCGAAA
GGAACCGCGAGCGAGAGCTGGCGATACAGACGGACGCCAAGTCGTCAAGCCACAACCGCAACACGCAGGGCTTCC
TACGACCGGGCCTCGAGGGTCGGGCCTTTACCAGCAGAGAACCGCTGACGGGAGCGGGCCTGGCCAGCCCGACTC
TCGTGACGGCGGATCAGGAGGATCCCTGGGCAAGAGCACGTCGTGATCTATCCGACATCCGGAGCATCTCTGGCT
AA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail