Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|07148
Gene name
Locationscaffold_09:748129..749955
Strand-
Gene length (bp)1826
Transcript length (bp)1485
Coding sequence length (bp)1485
Protein length (aa) 495

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00505 HMG_box HMG (high mobility group) box 3.6E-16 116 182
PF09011 HMG_box_2 HMG-box domain 3.0E-13 114 177
PF00536 SAM_1 SAM domain (Sterile alpha motif) 3.4E-10 11 58
PF07647 SAM_2 SAM domain (Sterile alpha motif) 4.0E-07 11 58

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3111 0.9039 0.1839 0.0177 0.0461 0.0011 0.0199 0.0251 0.0099 0.0111

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
HMG

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1127
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3549
Ophiocordyceps australis map64 (Brazil) OphauB2|1703
Ophiocordyceps camponoti-floridani Ophcf2|07148 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6040
Ophiocordyceps kimflemingae Ophio5|2278
Ophiocordyceps subramaniannii Hirsu2|10186

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|07148
MTRQLDGVFAELGLSQYLEAFIDQGFDAWDTILDIQESDLDALGVKLGHRRKLQRRIANSRGIAPSVSLACAKPN
ADEAKPDATRRDSIRSEPGHESNGVAKRKYRRHPKPDENAPERPPSAYVLFSNKMREDLKSHNLTFTEIAKLVGE
NWQNLPSAEKESYESQANAAKEKYHASLASYKKTPEYRKYLQYLHDFKEKQARQSKGHDAAKRLRLEPPRLQHSS
TTCTATPGGATPGGSRSGSSSERLRGSEPPSSRSESQTTPVTVSGLHTPLTPAHLNNEESKPTRFETDDESTRRN
PSWSRRSGRQPLPSLSDMLVDDGSKADGGGVYSHAGSGSGQTRMVPDGPPIIPRTRVPRLVHEPSSNSTVGSRSS
RGSFGRSSGDGSVPIYALLADRTLPASSAMEMSSPAIKVAAASLASRLDSPNRPMASPKGYGFLSDSSAFQNMKI
DSLGDGDVLMSPVSSPTTASSKRGLDGMSALLHAGEIVGRRDHG*
Coding >Ophcf2|07148
ATGACGCGACAACTCGACGGCGTCTTCGCAGAGTTGGGTCTGTCCCAATATCTCGAGGCCTTTATCGATCAGGGC
TTCGATGCCTGGGACACCATTTTGGATATCCAAGAGTCGGATCTGGATGCCTTGGGCGTCAAGCTGGGCCACCGG
AGGAAACTCCAGCGGCGCATCGCAAACTCGCGCGGCATCGCTCCGAGCGTCTCTCTCGCCTGCGCTAAGCCCAAC
GCCGACGAGGCCAAGCCCGATGCCACTCGACGAGATTCCATCCGCAGCGAGCCTGGCCACGAGTCCAACGGAGTG
GCCAAGCGCAAGTATCGTCGCCATCCCAAGCCGGACGAGAATGCCCCGGAGCGACCGCCATCGGCCTACGTTCTC
TTTTCCAATAAAATGAGGGAAGATCTCAAGTCCCACAACCTCACCTTTACCGAAATCGCGAAGCTAGTGGGCGAG
AACTGGCAGAACCTACCGTCGGCCGAGAAGGAGTCGTACGAGAGCCAAGCCAACGCGGCCAAAGAAAAGTACCAT
GCCAGCCTGGCCAGTTACAAGAAGACGCCGGAATATCGCAAGTACCTTCAATACCTCCACGACTTTAAGGAAAAG
CAGGCCAGGCAAAGCAAAGGCCACGATGCCGCCAAGAGATTGAGGCTAGAACCGCCGCGGCTTCAGCACTCGAGT
ACCACCTGCACAGCGACTCCCGGCGGAGCTACCCCCGGAGGAAGTCGGAGCGGTAGTAGCAGCGAGAGGTTGCGA
GGCAGCGAGCCTCCGTCGTCCCGGAGCGAGAGTCAGACGACGCCGGTGACGGTGTCGGGACTGCATACGCCCTTG
ACGCCCGCACATCTCAACAACGAAGAGTCGAAGCCAACCCGGTTCGAGACGGATGATGAGAGCACGCGTCGGAAT
CCTTCGTGGTCGCGGAGAAGCGGTCGTCAACCCCTGCCGTCGTTGTCCGACATGCTGGTGGACGACGGAAGCAAG
GCGGATGGCGGTGGCGTTTACTCGCACGCCGGGTCCGGCTCCGGTCAGACGAGGATGGTTCCGGATGGGCCGCCC
ATCATACCCCGGACGCGAGTGCCGCGCCTCGTACACGAGCCGTCATCCAACAGCACTGTCGGTTCGCGAAGTTCC
AGGGGGAGTTTCGGGAGGTCTTCTGGCGACGGATCGGTGCCTATCTACGCTCTACTCGCCGACCGAACTCTACCA
GCCTCATCCGCAATGGAGATGTCGTCACCGGCCATCAAGGTGGCAGCCGCTAGCCTTGCCAGCCGTCTAGATTCG
CCGAACCGACCGATGGCGAGTCCCAAGGGCTACGGCTTCCTCTCCGACTCATCGGCCTTTCAGAACATGAAGATT
GATTCGTTGGGCGATGGCGATGTGCTCATGTCGCCCGTCTCATCGCCCACCACCGCCTCATCGAAGCGCGGTCTC
GACGGCATGAGCGCCTTACTTCACGCGGGCGAGATTGTTGGACGACGAGACCATGGTTGA
Transcript >Ophcf2|07148
ATGACGCGACAACTCGACGGCGTCTTCGCAGAGTTGGGTCTGTCCCAATATCTCGAGGCCTTTATCGATCAGGGC
TTCGATGCCTGGGACACCATTTTGGATATCCAAGAGTCGGATCTGGATGCCTTGGGCGTCAAGCTGGGCCACCGG
AGGAAACTCCAGCGGCGCATCGCAAACTCGCGCGGCATCGCTCCGAGCGTCTCTCTCGCCTGCGCTAAGCCCAAC
GCCGACGAGGCCAAGCCCGATGCCACTCGACGAGATTCCATCCGCAGCGAGCCTGGCCACGAGTCCAACGGAGTG
GCCAAGCGCAAGTATCGTCGCCATCCCAAGCCGGACGAGAATGCCCCGGAGCGACCGCCATCGGCCTACGTTCTC
TTTTCCAATAAAATGAGGGAAGATCTCAAGTCCCACAACCTCACCTTTACCGAAATCGCGAAGCTAGTGGGCGAG
AACTGGCAGAACCTACCGTCGGCCGAGAAGGAGTCGTACGAGAGCCAAGCCAACGCGGCCAAAGAAAAGTACCAT
GCCAGCCTGGCCAGTTACAAGAAGACGCCGGAATATCGCAAGTACCTTCAATACCTCCACGACTTTAAGGAAAAG
CAGGCCAGGCAAAGCAAAGGCCACGATGCCGCCAAGAGATTGAGGCTAGAACCGCCGCGGCTTCAGCACTCGAGT
ACCACCTGCACAGCGACTCCCGGCGGAGCTACCCCCGGAGGAAGTCGGAGCGGTAGTAGCAGCGAGAGGTTGCGA
GGCAGCGAGCCTCCGTCGTCCCGGAGCGAGAGTCAGACGACGCCGGTGACGGTGTCGGGACTGCATACGCCCTTG
ACGCCCGCACATCTCAACAACGAAGAGTCGAAGCCAACCCGGTTCGAGACGGATGATGAGAGCACGCGTCGGAAT
CCTTCGTGGTCGCGGAGAAGCGGTCGTCAACCCCTGCCGTCGTTGTCCGACATGCTGGTGGACGACGGAAGCAAG
GCGGATGGCGGTGGCGTTTACTCGCACGCCGGGTCCGGCTCCGGTCAGACGAGGATGGTTCCGGATGGGCCGCCC
ATCATACCCCGGACGCGAGTGCCGCGCCTCGTACACGAGCCGTCATCCAACAGCACTGTCGGTTCGCGAAGTTCC
AGGGGGAGTTTCGGGAGGTCTTCTGGCGACGGATCGGTGCCTATCTACGCTCTACTCGCCGACCGAACTCTACCA
GCCTCATCCGCAATGGAGATGTCGTCACCGGCCATCAAGGTGGCAGCCGCTAGCCTTGCCAGCCGTCTAGATTCG
CCGAACCGACCGATGGCGAGTCCCAAGGGCTACGGCTTCCTCTCCGACTCATCGGCCTTTCAGAACATGAAGATT
GATTCGTTGGGCGATGGCGATGTGCTCATGTCGCCCGTCTCATCGCCCACCACCGCCTCATCGAAGCGCGGTCTC
GACGGCATGAGCGCCTTACTTCACGCGGGCGAGATTGTTGGACGACGAGACCATGGTTGA
Gene >Ophcf2|07148
ATGACGCGACAACTCGACGGCGTCTTCGCAGAGTTGGGTCTGTCCCAATATCTCGAGGCCTTTATCGATCAGGGC
TTCGATGCCTGGGACACCATTTTGGATATCCAAGAGTCGGATCTGTTGGTCATCACCTATCCATAAACCCCCCTA
TTGCCTTCCAGCCACTGACTCGAACCTTTTCAAGGGATGCCTTGGGCGTCAAGCTGGGCCACCGGAGGGTACGTC
GGACCCGCACATGGTCGATCCCGGAGTCGAGCTGACATGAGAGCTTCAGAAACTCCAGCGGCGCATCGCAAACTC
GCGCGGCATCGCTCCGAGCGTCTCTCTCGCCTGCGCTAAGCCCAACGCCGACGAGGCCAAGCCCGATGCCACTCG
ACGAGATTCCATCCGCAGCGAGCCTGGCCACGAGTCCAACGGAGTGGCCAAGCGCAAGTATCGTCGCCATCCCAA
GGTTCGTCGACTGACCATCTGATGACGTCTGTATATCTGACCGACGTAGCCGGACGAGAATGCCCCGGAGCGACC
GCCATCGGCCTACGTTCTCTTTTCCAATAGTGAGTTCCGGTTCGCTGTCTTCGTCGGTTCAATTCGGAGCTGACC
AGCTGCACCAGAAATGAGGGAAGATCTCAAGTCCCACAACCTCACCTTTACCGAAATCGCGAAGCTAGTGGGCGA
GAACTGGCAGAACCTACCGTCGGCCGAGAAGGAGTCGTACGAGAGCCAAGCCAACGCGGCCAAAGAAAAGTACCA
TGCCAGCCTGGCCAGTTACAAGAAGACGCCGGAATATCGCAAGTACCTTCAATACCTCCACGACTTTAAGGAAAA
GCAGGCCAGGCAAAGCAAAGGTTCGAACCGTGCCCTTACCACCGACGGGAAAGCCCCGTCTGACAAGACGTTGCA
GGCCACGATGCCGCCAAGAGATTGAGGCTAGAACCGCCGCGGCTTCAGCACTCGAGTACCACCTGCACAGCGACT
CCCGGCGGAGCTACCCCCGGAGGAAGTCGGAGCGGTAGTAGCAGCGAGAGGTTGCGAGGCAGCGAGCCTCCGTCG
TCCCGGAGCGAGAGTCAGACGACGCCGGTGACGGTGTCGGGACTGCATACGCCCTTGACGCCCGCACATCTCAAC
AACGAAGAGTCGAAGCCAACCCGGTTCGAGACGGATGATGAGAGCACGCGTCGGAATCCTTCGTGGTCGCGGAGA
AGCGGTCGTCAACCCCTGCCGTCGTTGTCCGACATGCTGGTGGACGACGGAAGCAAGGCGGATGGCGGTGGCGTT
TACTCGCACGCCGGGTCCGGCTCCGGTCAGACGAGGATGGTTCCGGATGGGCCGCCCATCATACCCCGGACGCGA
GTGCCGCGCCTCGTACACGAGCCGTCATCCAACAGCACTGTCGGTTCGCGAAGTTCCAGGGGGAGTTTCGGGAGG
TCTTCTGGCGACGGATCGGTGCCTATCTACGCTCTACTCGCCGACCGAACTCTACCAGCCTCATCCGCAATGGAG
ATGTCGTCACCGGCCATCAAGGTGGCAGCCGCTAGCCTTGCCAGCCGTCTAGATTCGCCGAACCGACCGATGGCG
AGTCCCAAGGGCTACGGTGAGCAGGTCTTGAACGAACGGTGTCGGGAGAAGGGGGCTAACATGAGACACATCTAG
GCTTCCTCTCCGACTCATCGGCCTTTCAGAACATGAAGATTGATTCGTTGGGCGATGGCGATGTGCTCATGTCGC
CCGTCTCATCGCCCACCACCGCCTCATCGAAGCGCGGTCTCGACGGCATGAGCGCCTTACTTCACGCGGGCGAGA
TTGTTGGACGACGAGACCATGGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail