Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|07147
Gene name
Locationscaffold_09:745049..747595
Strand+
Gene length (bp)2546
Transcript length (bp)2328
Coding sequence length (bp)2328
Protein length (aa) 776

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05786 Cnd2 Condensin complex subunit 2 1.1E-268 20 766

GO

GO Term Description Terminal node
GO:0000796 condensin complex Yes
GO:0007076 mitotic chromosome condensation Yes
GO:0005575 cellular_component No
GO:0044815 DNA packaging complex No
GO:0030261 chromosome condensation No
GO:0051276 chromosome organization No
GO:0071840 cellular component organization or biogenesis No
GO:0022402 cell cycle process No
GO:1903047 mitotic cell cycle process No
GO:0008150 biological_process No
GO:0032991 protein-containing complex No
GO:0006996 organelle organization No
GO:0009987 cellular process No
GO:0016043 cellular component organization No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.288 0.9071 0.0114 0.0314 0.2463 0.0023 0.0412 0.0643 0.017 0.0196

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4333
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3548
Ophiocordyceps australis map64 (Brazil) OphauB2|1702
Ophiocordyceps camponoti-floridani Ophcf2|07147 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6041
Ophiocordyceps kimflemingae Ophio5|2709
Ophiocordyceps subramaniannii Hirsu2|890

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|07147
MPRVAQVPRPGGAATASMPASPFKSPVKIPLNDDAHEKGQRLNSRKALHERHIKQIKAAATPRKHASSVMDSEGA
SPRTPGSQDEAITVGGVTPMKRVPILANFEEWMKMATDNKINATNSWNFALIDYFHDMSLLKEGDGVNFQKASCT
LDGCVKIYTNRVDSVATETGKLLSGLSDSKKKDGEGEGEGEDAGTDDDVDGEGGGRTKAKKKTQRWSEATLAPSF
AALQLKKFELEFAVDPLFKKASADFDEGGARGLLLNHLMIDSRGRIVFDSSDDSEDAVGHDKKQDDDQEEDKADD
AEEENAPIDLASLSQRFFPDLSRLDELDVCPSLKNFDLGGGSMDIPFLKAIEDEQKTSGDTSGAMMDDAANPLPD
YDDDDDDDHLGALTMAEDVAFGEGGEAWAREAALAPHMRVLNVERTGADADEDADEDDLEDGRADYNIISMTSGG
NVHDDMLNFFDQALCKNWTRAEHWRIRKIKDNSKGTETLKARRREKEPFEVDFLSPLNQPAIDALSTQASSNAAI
SLARKDWTAKSRNLVPEDGHFSSRSLLSLFLKPRARLASRRTRARRQVPLDMDEAFWAKQHHHHDDAHDDDDGPP
PGNYDADFFHDDGLPFPSSPPPHQTATKTSQTPAPTPPPQRKPTTLVTSTRRLRPEYVQYARRAKKVDVRRLKEE
MWRAMDFTTPPTDDDNPNSNNEKQDDNNDNNNDHSLLLTFTSILTSLQKAYPKQTMDDISTSYCFICLLHLANEK
GLQINKTPALDELFIQRDSSANLDD*
Coding >Ophcf2|07147
ATGCCTCGCGTCGCACAGGTTCCCCGTCCCGGAGGGGCAGCAACGGCTTCAATGCCCGCCTCGCCCTTCAAATCA
CCCGTCAAGATCCCCCTCAACGACGATGCGCACGAAAAGGGCCAGCGCCTCAACTCGCGCAAGGCCCTTCACGAG
CGTCATATCAAGCAGATCAAGGCGGCTGCCACGCCTCGAAAGCACGCTTCGTCCGTCATGGACTCGGAGGGGGCC
TCGCCTCGGACGCCGGGAAGTCAGGACGAGGCCATTACGGTTGGGGGCGTTACGCCTATGAAGAGGGTGCCTATC
CTGGCCAACTTTGAGGAGTGGATGAAGATGGCGACGGACAACAAGATTAACGCGACGAATTCGTGGAACTTTGCC
CTCATCGACTACTTTCATGACATGTCGTTGCTCAAGGAAGGCGATGGCGTCAACTTTCAGAAGGCGAGCTGTACG
CTTGACGGCTGCGTCAAGATCTATACGAATCGGGTTGATAGCGTTGCGACGGAGACGGGCAAGTTGCTGAGCGGC
CTCTCGGATAGCAAGAAGAAGGATGGCGAGGGAGAGGGAGAAGGGGAGGACGCTGGGACGGATGACGACGTCGAT
GGTGAAGGCGGCGGGAGAACAAAGGCCAAGAAGAAGACGCAACGATGGTCAGAGGCGACGCTCGCTCCCTCGTTC
GCCGCCCTGCAGCTCAAGAAATTCGAGCTCGAATTCGCCGTCGATCCGCTCTTCAAGAAGGCTTCGGCCGACTTC
GACGAGGGCGGTGCCAGGGGTCTGCTTCTCAACCACCTGATGATTGACTCTCGGGGACGCATCGTCTTTGACAGC
AGCGACGACTCGGAAGATGCAGTCGGCCATGATAAGAAGCAAGATGATGACCAAGAAGAAGACAAAGCAGACGAT
GCGGAAGAAGAGAATGCGCCCATCGATCTAGCCTCGCTCAGCCAACGATTCTTCCCCGACCTCTCACGGCTCGAC
GAACTCGACGTCTGTCCATCACTCAAGAACTTTGATCTCGGCGGCGGAAGCATGGACATTCCCTTCCTCAAGGCA
ATCGAAGACGAACAAAAGACCAGCGGCGACACATCCGGCGCCATGATGGACGACGCAGCAAACCCTCTTCCGGAC
TACGACGACGACGACGACGACGACCATCTAGGCGCCCTGACCATGGCCGAAGACGTAGCCTTTGGCGAAGGAGGC
GAAGCCTGGGCCCGAGAAGCAGCTCTAGCCCCCCACATGCGCGTCCTCAACGTCGAAAGAACAGGAGCAGACGCA
GACGAAGACGCAGACGAAGACGACTTGGAAGACGGAAGAGCCGACTACAACATCATCTCCATGACGAGCGGCGGA
AACGTGCACGACGACATGCTAAACTTCTTCGACCAAGCCCTCTGCAAAAACTGGACGAGAGCGGAACACTGGCGC
ATCCGCAAGATCAAAGACAACAGCAAAGGCACGGAAACTCTCAAGGCACGCCGTCGCGAAAAGGAACCCTTTGAA
GTCGACTTCCTCTCCCCGCTCAACCAGCCGGCCATAGACGCCCTCTCGACGCAAGCTTCCAGCAACGCAGCCATA
AGCCTCGCCCGCAAAGACTGGACCGCCAAGTCGCGCAACCTCGTGCCCGAAGACGGCCACTTCTCCTCCCGCTCT
CTACTGAGTCTCTTTCTGAAGCCGAGGGCGAGACTGGCTTCGAGGAGGACCCGCGCTCGGCGACAAGTCCCCCTC
GACATGGACGAAGCCTTCTGGGCCAAACAACATCATCACCATGATGATGCCCACGACGACGACGACGGACCGCCC
CCCGGGAATTACGACGCCGATTTCTTCCACGACGATGGCCTCCCCTTCCCCTCTTCCCCTCCGCCCCATCAGACT
GCGACGAAGACTTCGCAGACGCCCGCTCCCACCCCTCCCCCGCAACGGAAGCCCACCACCCTCGTCACCTCGACG
CGGAGGCTGAGACCCGAGTACGTGCAGTACGCTCGACGCGCCAAGAAGGTCGACGTCAGGAGGTTAAAGGAGGAG
ATGTGGAGGGCCATGGACTTCACCACGCCTCCAACCGATGACGACAACCCCAACTCCAACAACGAAAAACAAGAC
GACAACAACGACAACAATAATGACCACTCCCTACTACTAACCTTCACCTCCATCCTAACCTCCCTCCAAAAAGCC
TACCCCAAACAAACAATGGACGACATCTCCACCTCCTACTGCTTCATCTGCCTCCTCCACCTCGCCAACGAAAAA
GGCCTTCAAATCAACAAGACGCCCGCCCTAGACGAACTCTTCATCCAGCGCGACTCTTCCGCCAATCTCGACGAC
TGA
Transcript >Ophcf2|07147
ATGCCTCGCGTCGCACAGGTTCCCCGTCCCGGAGGGGCAGCAACGGCTTCAATGCCCGCCTCGCCCTTCAAATCA
CCCGTCAAGATCCCCCTCAACGACGATGCGCACGAAAAGGGCCAGCGCCTCAACTCGCGCAAGGCCCTTCACGAG
CGTCATATCAAGCAGATCAAGGCGGCTGCCACGCCTCGAAAGCACGCTTCGTCCGTCATGGACTCGGAGGGGGCC
TCGCCTCGGACGCCGGGAAGTCAGGACGAGGCCATTACGGTTGGGGGCGTTACGCCTATGAAGAGGGTGCCTATC
CTGGCCAACTTTGAGGAGTGGATGAAGATGGCGACGGACAACAAGATTAACGCGACGAATTCGTGGAACTTTGCC
CTCATCGACTACTTTCATGACATGTCGTTGCTCAAGGAAGGCGATGGCGTCAACTTTCAGAAGGCGAGCTGTACG
CTTGACGGCTGCGTCAAGATCTATACGAATCGGGTTGATAGCGTTGCGACGGAGACGGGCAAGTTGCTGAGCGGC
CTCTCGGATAGCAAGAAGAAGGATGGCGAGGGAGAGGGAGAAGGGGAGGACGCTGGGACGGATGACGACGTCGAT
GGTGAAGGCGGCGGGAGAACAAAGGCCAAGAAGAAGACGCAACGATGGTCAGAGGCGACGCTCGCTCCCTCGTTC
GCCGCCCTGCAGCTCAAGAAATTCGAGCTCGAATTCGCCGTCGATCCGCTCTTCAAGAAGGCTTCGGCCGACTTC
GACGAGGGCGGTGCCAGGGGTCTGCTTCTCAACCACCTGATGATTGACTCTCGGGGACGCATCGTCTTTGACAGC
AGCGACGACTCGGAAGATGCAGTCGGCCATGATAAGAAGCAAGATGATGACCAAGAAGAAGACAAAGCAGACGAT
GCGGAAGAAGAGAATGCGCCCATCGATCTAGCCTCGCTCAGCCAACGATTCTTCCCCGACCTCTCACGGCTCGAC
GAACTCGACGTCTGTCCATCACTCAAGAACTTTGATCTCGGCGGCGGAAGCATGGACATTCCCTTCCTCAAGGCA
ATCGAAGACGAACAAAAGACCAGCGGCGACACATCCGGCGCCATGATGGACGACGCAGCAAACCCTCTTCCGGAC
TACGACGACGACGACGACGACGACCATCTAGGCGCCCTGACCATGGCCGAAGACGTAGCCTTTGGCGAAGGAGGC
GAAGCCTGGGCCCGAGAAGCAGCTCTAGCCCCCCACATGCGCGTCCTCAACGTCGAAAGAACAGGAGCAGACGCA
GACGAAGACGCAGACGAAGACGACTTGGAAGACGGAAGAGCCGACTACAACATCATCTCCATGACGAGCGGCGGA
AACGTGCACGACGACATGCTAAACTTCTTCGACCAAGCCCTCTGCAAAAACTGGACGAGAGCGGAACACTGGCGC
ATCCGCAAGATCAAAGACAACAGCAAAGGCACGGAAACTCTCAAGGCACGCCGTCGCGAAAAGGAACCCTTTGAA
GTCGACTTCCTCTCCCCGCTCAACCAGCCGGCCATAGACGCCCTCTCGACGCAAGCTTCCAGCAACGCAGCCATA
AGCCTCGCCCGCAAAGACTGGACCGCCAAGTCGCGCAACCTCGTGCCCGAAGACGGCCACTTCTCCTCCCGCTCT
CTACTGAGTCTCTTTCTGAAGCCGAGGGCGAGACTGGCTTCGAGGAGGACCCGCGCTCGGCGACAAGTCCCCCTC
GACATGGACGAAGCCTTCTGGGCCAAACAACATCATCACCATGATGATGCCCACGACGACGACGACGGACCGCCC
CCCGGGAATTACGACGCCGATTTCTTCCACGACGATGGCCTCCCCTTCCCCTCTTCCCCTCCGCCCCATCAGACT
GCGACGAAGACTTCGCAGACGCCCGCTCCCACCCCTCCCCCGCAACGGAAGCCCACCACCCTCGTCACCTCGACG
CGGAGGCTGAGACCCGAGTACGTGCAGTACGCTCGACGCGCCAAGAAGGTCGACGTCAGGAGGTTAAAGGAGGAG
ATGTGGAGGGCCATGGACTTCACCACGCCTCCAACCGATGACGACAACCCCAACTCCAACAACGAAAAACAAGAC
GACAACAACGACAACAATAATGACCACTCCCTACTACTAACCTTCACCTCCATCCTAACCTCCCTCCAAAAAGCC
TACCCCAAACAAACAATGGACGACATCTCCACCTCCTACTGCTTCATCTGCCTCCTCCACCTCGCCAACGAAAAA
GGCCTTCAAATCAACAAGACGCCCGCCCTAGACGAACTCTTCATCCAGCGCGACTCTTCCGCCAATCTCGACGAC
TGA
Gene >Ophcf2|07147
ATGCCTCGCGTCGCACAGGTTCCCCGTCCCGGAGGGGCAGCAACGGCTTCAATGCCCGCCTCGCCCTTCAAATCA
CCCGTCAAGTAAGAAAGAAAAAAAAAAAAACTAAAGCAGGCCGTTTCTGCGACCGCTCGCGCTCACCTCGGACCA
CAGGATCCCCCTCAACGACGATGCGCACGAAAAGGGCCAGCGCCTCAACTCGCGCAAGGCCCTTCACGAGCGTCA
TATCAAGCAGATCAAGGCGGCTGCCACGCCTCGAAAGCACGCTTCGTCCGTCATGGACTCGGAGGGGGCCTCGCC
TCGGACGCCGGGAAGTCAGGACGAGGCCATTACGGTTGGGGGCGTTACGCCTATGAAGAGGGTGCCTATCCTGGC
CAACTTTGAGGAGTGGATGAAGATGGCGACGGACAACAAGATTAACGCGACGAATTCGTGGAACTTTGCCCTCAT
CGACTACTTTCATGACATGTCGTTGCTCAAGGAAGGCGATGGCGTCAACTTTCAGAAGGCGAGCTGTACGCTTGA
CGGCTGCGTCAAGATCTATACGAATCGGGTTGATAGCGTTGCGACGGAGACGGGCAAGTTGCTGAGCGGCCTCTC
GGATAGCAAGAAGAAGGATGGCGAGGGAGAGGGAGAAGGGGAGGACGCTGGGACGGATGACGACGTCGATGGTGA
AGGCGGCGGGAGAACAAAGGCCAAGAAGAAGGTGAGAAGTTGAAATCTCGATGAGTCCTCTTTCCACGACTGACA
GGCGCGCAAGACGCAACGATGGTCAGAGGCGACGCTCGCTCCCTCGTTCGCCGCCCTGCAGCTCAAGAAATTCGA
GCTCGAATTCGCCGTCGATCCGCTCTTCAAGAAGGCTTCGGCCGACTTCGACGAGGGCGGTGCCAGGGGTCTGCT
TCTCAACCACCTGATGATTGACTCTCGGGGACGCATCGTCTTTGACAGCAGCGACGACTCGGAAGATGCAGTCGG
CCATGATAAGAAGCAAGATGATGACCAAGAAGAAGACAAAGCAGACGATGCGGAAGAAGAGAATGCGCCCATCGA
TCTAGCCTCGCTCAGCCAACGATTCTTCCCCGACCTCTCACGGCTCGACGAACTCGACGTCTGTCCATCACTCAA
GAACTTTGATCTCGGCGGCGGAAGCATGGACATTCCCTTCCTCAAGGCAATCGAAGACGAACAAAAGACCAGCGG
CGACACATCCGGCGCCATGATGGACGACGCAGCAAACCCTCTTCCGGACTACGACGACGACGACGACGACGACCA
TCTAGGCGCCCTGACCATGGCCGAAGACGTAGCCTTTGGCGAAGGAGGCGAAGCCTGGGCCCGAGAAGCAGCTCT
AGCCCCCCACATGCGCGTCCTCAACGTCGAAAGAACAGGAGCAGACGCAGACGAAGACGCAGACGAAGACGACTT
GGAAGACGGAAGAGCCGACTACAACATCATCTCCATGACGAGCGGCGGAAACGTGCACGACGACATGCTAAACTT
CTTCGACCAAGCCCTCTGCAAAAACTGGACGAGAGCGGAACACTGGCGCATCCGCAAGATCAAAGACAACAGCAA
AGGCACGGAAACTCTCAAGGCACGCCGTCGCGAAAAGGAACCCTTTGAAGTCGACTTCCTCTCCCCGCTCAACCA
GCCGGCCATAGACGCCCTCTCGACGCAAGCTTCCAGCAACGCAGCCATAAGCCTCGCCCGCAAAGACTGGACCGC
CAAGTCGCGCAACCTCGTGCCCGAAGACGGCCACTTCTCCTCCCGCTCTCTACTGAGTCTCTTTCTGAAGCCGAG
GGCGAGACTGGCTTCGAGGAGGACCCGCGCTCGGCGACAAGTCCCCCTCGACATGGACGAAGCCTTCTGGGCCAA
ACAACATCATCACCATGATGATGCCCACGACGACGACGACGGACCGCCCCCCGGGAATTACGACGCCGATTTCTT
CCACGACGATGGCCTCCCCTTCCCCTCTTCCCCTCCGCCCCATCAGACTGCGACGAAGACTTCGCAGACGCCCGC
TCCCACCCCTCCCCCGCAACGGAAGCCCACCACGTCCCTCCTCCACAACAATGTACCCCTTCACCCAGCCCATCA
CCACCGCCGCCGCCGCCGCCGCCGCCGCCGCCAACACCGCCTTCGGAAGCAGCCTCGTCACCTCGACGCGGAGGC
TGAGACCCGAGTACGTGCAGTACGCTCGACGCGCCAAGAAGGTCGACGTCAGGAGGTTAAAGGAGGAGATGTGGA
GGGCCATGGACTTCACCACGCCTCCAACCGATGACGACAACCCCAACTCCAACAACGAAAAACAAGACGACAACA
ACGACAACAATAATGACCACTCCCTACTACTAACCTTCACCTCCATCCTAACCTCCCTCCAAAAAGCCTACCCCA
AACAAACAATGGACGACATCTCCACCTCCTACTGCTTCATCTGCCTCCTCCACCTCGCCAACGAAAAAGGCCTTC
AAATCAACAAGACGCCCGCCCTAGACGAACTCTTCATCCAGCGCGACTCTTCCGCCAATCTCGACGACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail