Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|07146
Gene name
Locationscaffold_09:741138..743968
Strand-
Gene length (bp)2830
Transcript length (bp)2772
Coding sequence length (bp)2772
Protein length (aa) 924

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01699 Na_Ca_ex Sodium/calcium exchanger protein 1.2E-28 108 246
PF01699 Na_Ca_ex Sodium/calcium exchanger protein 8.8E-24 741 903

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0016021 integral component of membrane Yes
GO:0005575 cellular_component No
GO:0051179 localization No
GO:0008150 biological_process No
GO:0031224 intrinsic component of membrane No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0110165 cellular anatomical entity No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 28 0.45

Transmembrane Domains

Domain # Start End Length
1 12 29 17
2 100 122 22
3 129 151 22
4 173 195 22
5 208 230 22
6 235 252 17
7 560 579 19
8 670 692 22
9 705 727 22
10 737 759 22
11 766 788 22
12 803 825 22
13 855 877 22
14 887 909 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 55.55 31.03 80.07
Alive In ants, during behavior modification 126.16 62.06 190.26
Dead In ants, recently dead 116.35 59.44 173.26

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.720631 no
Dead Fungus 0.000238 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|07146
MLSNRSRPPSRPFVVALVALALLTAYSFLNRGPSPDPSSSSHDGSYPAHIRRHHHDDTACRNIDAVADKCAFVKR
HCADVDASLIPYLELYYCTHQSARPLSFSLLVAWLGLLFSTIGIAASDFFCVNLATISAVLGLSQSLAGVTFLAL
GNGSPDVFSTFAAMSSNSPGMAIGELIGAASFIAGVVAGSMALVREFRVDRKTYARDICFFIVAVAFTMAFLADG
NLHIWECCVMIGYYALYVITVVVSHWYDVRARRELRRDTESRSHVYVMDGHAEELAGEPYRDDDRSPLPVTPVTL
EAGSLVDDDGHHERLAAAEVTNNMRVVRSSHKRPPITTPIRPSLVGALEFRAALAQLQRESNLHLSPLLVRGQSQ
SRPLLRRGTTCNALFGGSDDGTGVSTPVPSLARRDRALSSSDIPVASTVVPADLMDARLGSTGSRFLTPEAAQPE
RTNPSPTPSLPVIAVEPPDETNHEPSRESIPKLRLEIPGHSRSPSATSSPETAFPRYVDPSALGDDDVQPPAPVS
VRWWPYRVLPPPDVLLATLFPTLQGWREKSYWDRLLSAISVPSIFLLVITLPVVDMEATEEATMERDLLSDGPSY
GAMEGSAPAISVIPADAQAETGWENYRLSPAADPSAEAMEGVASRGSVMSAKAPSEIRSASKGSKEPPSWNRWLV
CVQLFSGPLFSTLILWANMREDMGRPVRELVRMVAFSLLLSALLLAVVLMTTTGQRRPRLHYLLCFLGFVISVAW
ISTIAGEVVGVLKAFGVILGISEALLGLTVFAAGNSIGDLVADITVARLGYPVMALSACFGGPMLNILLGIGIGG
VMMMMKQANKEHGQHPGEPMRYGPYRMQMGATLFVSGVTLLLMLVVLVVLVPMNKWILSRRIGWLVIMMWVVSTA
VSVVVELTGKSSGLASVDVEWLP*
Coding >Ophcf2|07146
ATGCTCTCTAACCGCTCCAGACCCCCGTCACGCCCCTTTGTCGTCGCCCTCGTCGCCCTCGCCCTCCTGACGGCC
TATTCGTTCCTCAACCGAGGCCCTTCACCCGACCCGTCCTCCTCTTCCCATGATGGGTCTTATCCCGCCCATATC
CGCCGTCACCATCATGACGACACGGCCTGTCGCAACATCGACGCCGTCGCCGACAAGTGCGCCTTTGTCAAGCGT
CACTGCGCCGACGTCGACGCCAGCCTCATCCCCTATCTCGAGCTCTACTACTGCACCCATCAGAGCGCGAGACCC
CTCTCCTTCTCCCTCCTCGTCGCCTGGCTCGGTCTGCTCTTTTCCACCATCGGCATCGCTGCCAGCGACTTCTTC
TGCGTCAACCTCGCCACCATCTCCGCCGTCCTCGGCCTGAGCCAGAGCCTCGCCGGCGTCACCTTTCTCGCCCTC
GGCAACGGCTCCCCCGATGTCTTCAGCACCTTTGCCGCCATGAGTTCAAACAGCCCCGGCATGGCCATAGGCGAG
CTCATCGGCGCTGCCAGCTTCATCGCCGGCGTCGTTGCCGGTTCCATGGCCCTCGTTCGCGAGTTCCGCGTCGAC
CGCAAGACGTACGCACGCGATATTTGCTTCTTCATCGTCGCCGTCGCCTTCACCATGGCCTTCCTGGCCGACGGC
AACCTTCACATCTGGGAGTGCTGTGTCATGATCGGCTATTACGCGCTCTACGTCATCACCGTCGTCGTCAGTCAC
TGGTACGATGTCAGGGCCAGGCGCGAGCTCCGGCGAGACACAGAGTCTCGCAGCCACGTCTATGTCATGGATGGT
CACGCTGAGGAGCTGGCGGGCGAGCCCTATCGAGACGACGACCGTTCGCCCTTGCCCGTCACCCCCGTCACTCTC
GAAGCCGGCTCGCTCGTTGATGACGACGGCCATCACGAACGGTTGGCAGCGGCCGAGGTGACGAATAATATGCGC
GTCGTGCGATCGAGCCATAAGCGGCCTCCGATCACGACTCCCATCCGTCCGAGTCTGGTGGGCGCTCTCGAATTC
CGCGCTGCTCTGGCCCAGCTCCAGCGCGAGAGCAACCTGCATCTCTCGCCCCTGCTGGTCCGGGGCCAGTCCCAG
TCTCGGCCCCTGCTGCGGCGTGGGACAACGTGCAATGCCCTGTTCGGGGGTAGCGACGACGGCACCGGTGTCTCG
ACTCCCGTGCCCAGCCTCGCACGCAGGGATCGCGCCCTGTCGTCGAGCGACATACCGGTCGCTTCCACCGTCGTC
CCCGCTGATCTCATGGACGCACGCCTCGGCAGTACGGGGTCTCGGTTTCTGACGCCCGAGGCGGCCCAGCCGGAG
CGGACGAATCCGTCGCCAACGCCCTCGTTGCCCGTCATAGCAGTCGAGCCACCCGACGAGACGAATCATGAACCG
TCGCGGGAATCCATCCCGAAGCTGAGGCTGGAGATACCGGGCCATTCGAGGAGTCCCAGTGCAACGTCGTCGCCT
GAAACGGCTTTCCCCCGCTACGTCGATCCGAGCGCGCTCGGAGACGACGACGTCCAGCCTCCGGCCCCTGTTTCG
GTCCGATGGTGGCCGTATCGGGTGCTTCCCCCGCCTGACGTCCTGCTGGCGACGCTGTTCCCGACCCTGCAGGGC
TGGCGGGAAAAGTCTTACTGGGATCGTTTACTCAGCGCGATATCGGTCCCCAGCATTTTCCTGCTGGTGATAACG
CTGCCCGTCGTGGACATGGAGGCGACCGAAGAAGCCACGATGGAGCGAGATCTCCTGTCCGATGGCCCGAGCTAT
GGTGCCATGGAAGGCTCGGCGCCGGCCATTTCCGTGATCCCTGCCGACGCCCAGGCCGAAACCGGCTGGGAAAAT
TATCGGTTGTCGCCGGCAGCGGACCCGTCGGCCGAAGCGATGGAAGGCGTCGCATCGAGAGGCTCCGTCATGTCT
GCCAAGGCGCCATCGGAGATACGGTCGGCGAGCAAGGGTAGCAAGGAGCCGCCGTCGTGGAACCGATGGCTAGTC
TGTGTTCAGCTCTTCAGCGGGCCGCTATTTTCGACGCTGATCCTGTGGGCCAACATGCGGGAGGACATGGGACGA
CCGGTGCGGGAGCTGGTGCGGATGGTGGCCTTTTCGTTGTTGCTGTCGGCCTTGCTGCTGGCAGTGGTGCTGATG
ACGACGACGGGCCAGAGGCGACCGCGGCTCCACTACCTGCTATGCTTCCTGGGCTTCGTTATCAGCGTCGCGTGG
ATATCGACGATCGCGGGCGAAGTGGTCGGGGTGCTCAAGGCCTTTGGCGTCATCCTGGGCATATCGGAGGCGCTG
CTGGGACTGACGGTGTTCGCAGCGGGCAACAGCATCGGAGATCTGGTGGCGGACATAACGGTCGCGCGACTGGGG
TATCCGGTCATGGCGCTGTCTGCGTGCTTCGGAGGACCCATGCTCAACATCCTGCTGGGCATCGGCATCGGGGGC
GTCATGATGATGATGAAGCAGGCCAACAAGGAGCACGGGCAGCATCCGGGGGAGCCGATGCGATACGGCCCGTAC
AGGATGCAGATGGGAGCGACGCTGTTCGTGTCGGGGGTGACGCTGCTGCTGATGCTGGTGGTGCTGGTGGTGCTT
GTGCCGATGAACAAGTGGATACTGAGCCGTCGGATCGGCTGGCTGGTGATTATGATGTGGGTTGTGAGCACGGCT
GTGAGCGTCGTGGTCGAGTTGACGGGTAAGTCGAGCGGGCTGGCGTCCGTCGACGTAGAATGGCTACCCTAG
Transcript >Ophcf2|07146
ATGCTCTCTAACCGCTCCAGACCCCCGTCACGCCCCTTTGTCGTCGCCCTCGTCGCCCTCGCCCTCCTGACGGCC
TATTCGTTCCTCAACCGAGGCCCTTCACCCGACCCGTCCTCCTCTTCCCATGATGGGTCTTATCCCGCCCATATC
CGCCGTCACCATCATGACGACACGGCCTGTCGCAACATCGACGCCGTCGCCGACAAGTGCGCCTTTGTCAAGCGT
CACTGCGCCGACGTCGACGCCAGCCTCATCCCCTATCTCGAGCTCTACTACTGCACCCATCAGAGCGCGAGACCC
CTCTCCTTCTCCCTCCTCGTCGCCTGGCTCGGTCTGCTCTTTTCCACCATCGGCATCGCTGCCAGCGACTTCTTC
TGCGTCAACCTCGCCACCATCTCCGCCGTCCTCGGCCTGAGCCAGAGCCTCGCCGGCGTCACCTTTCTCGCCCTC
GGCAACGGCTCCCCCGATGTCTTCAGCACCTTTGCCGCCATGAGTTCAAACAGCCCCGGCATGGCCATAGGCGAG
CTCATCGGCGCTGCCAGCTTCATCGCCGGCGTCGTTGCCGGTTCCATGGCCCTCGTTCGCGAGTTCCGCGTCGAC
CGCAAGACGTACGCACGCGATATTTGCTTCTTCATCGTCGCCGTCGCCTTCACCATGGCCTTCCTGGCCGACGGC
AACCTTCACATCTGGGAGTGCTGTGTCATGATCGGCTATTACGCGCTCTACGTCATCACCGTCGTCGTCAGTCAC
TGGTACGATGTCAGGGCCAGGCGCGAGCTCCGGCGAGACACAGAGTCTCGCAGCCACGTCTATGTCATGGATGGT
CACGCTGAGGAGCTGGCGGGCGAGCCCTATCGAGACGACGACCGTTCGCCCTTGCCCGTCACCCCCGTCACTCTC
GAAGCCGGCTCGCTCGTTGATGACGACGGCCATCACGAACGGTTGGCAGCGGCCGAGGTGACGAATAATATGCGC
GTCGTGCGATCGAGCCATAAGCGGCCTCCGATCACGACTCCCATCCGTCCGAGTCTGGTGGGCGCTCTCGAATTC
CGCGCTGCTCTGGCCCAGCTCCAGCGCGAGAGCAACCTGCATCTCTCGCCCCTGCTGGTCCGGGGCCAGTCCCAG
TCTCGGCCCCTGCTGCGGCGTGGGACAACGTGCAATGCCCTGTTCGGGGGTAGCGACGACGGCACCGGTGTCTCG
ACTCCCGTGCCCAGCCTCGCACGCAGGGATCGCGCCCTGTCGTCGAGCGACATACCGGTCGCTTCCACCGTCGTC
CCCGCTGATCTCATGGACGCACGCCTCGGCAGTACGGGGTCTCGGTTTCTGACGCCCGAGGCGGCCCAGCCGGAG
CGGACGAATCCGTCGCCAACGCCCTCGTTGCCCGTCATAGCAGTCGAGCCACCCGACGAGACGAATCATGAACCG
TCGCGGGAATCCATCCCGAAGCTGAGGCTGGAGATACCGGGCCATTCGAGGAGTCCCAGTGCAACGTCGTCGCCT
GAAACGGCTTTCCCCCGCTACGTCGATCCGAGCGCGCTCGGAGACGACGACGTCCAGCCTCCGGCCCCTGTTTCG
GTCCGATGGTGGCCGTATCGGGTGCTTCCCCCGCCTGACGTCCTGCTGGCGACGCTGTTCCCGACCCTGCAGGGC
TGGCGGGAAAAGTCTTACTGGGATCGTTTACTCAGCGCGATATCGGTCCCCAGCATTTTCCTGCTGGTGATAACG
CTGCCCGTCGTGGACATGGAGGCGACCGAAGAAGCCACGATGGAGCGAGATCTCCTGTCCGATGGCCCGAGCTAT
GGTGCCATGGAAGGCTCGGCGCCGGCCATTTCCGTGATCCCTGCCGACGCCCAGGCCGAAACCGGCTGGGAAAAT
TATCGGTTGTCGCCGGCAGCGGACCCGTCGGCCGAAGCGATGGAAGGCGTCGCATCGAGAGGCTCCGTCATGTCT
GCCAAGGCGCCATCGGAGATACGGTCGGCGAGCAAGGGTAGCAAGGAGCCGCCGTCGTGGAACCGATGGCTAGTC
TGTGTTCAGCTCTTCAGCGGGCCGCTATTTTCGACGCTGATCCTGTGGGCCAACATGCGGGAGGACATGGGACGA
CCGGTGCGGGAGCTGGTGCGGATGGTGGCCTTTTCGTTGTTGCTGTCGGCCTTGCTGCTGGCAGTGGTGCTGATG
ACGACGACGGGCCAGAGGCGACCGCGGCTCCACTACCTGCTATGCTTCCTGGGCTTCGTTATCAGCGTCGCGTGG
ATATCGACGATCGCGGGCGAAGTGGTCGGGGTGCTCAAGGCCTTTGGCGTCATCCTGGGCATATCGGAGGCGCTG
CTGGGACTGACGGTGTTCGCAGCGGGCAACAGCATCGGAGATCTGGTGGCGGACATAACGGTCGCGCGACTGGGG
TATCCGGTCATGGCGCTGTCTGCGTGCTTCGGAGGACCCATGCTCAACATCCTGCTGGGCATCGGCATCGGGGGC
GTCATGATGATGATGAAGCAGGCCAACAAGGAGCACGGGCAGCATCCGGGGGAGCCGATGCGATACGGCCCGTAC
AGGATGCAGATGGGAGCGACGCTGTTCGTGTCGGGGGTGACGCTGCTGCTGATGCTGGTGGTGCTGGTGGTGCTT
GTGCCGATGAACAAGTGGATACTGAGCCGTCGGATCGGCTGGCTGGTGATTATGATGTGGGTTGTGAGCACGGCT
GTGAGCGTCGTGGTCGAGTTGACGGGTAAGTCGAGCGGGCTGGCGTCCGTCGACGTAGAATGGCTACCCTAG
Gene >Ophcf2|07146
ATGCTCTCTAACCGCTCCAGACCCCCGTCACGCCCCTTTGTCGTCGCCCTCGTCGCCCTCGCCCTCCTGACGGCC
TATTCGTTCCTCAACCGAGGCCCTTCACCCGACCCGTCCTCCTCTTCCCATGATGGGTCTTATCCCGCCCATATC
CGCCGTCACCATCATGACGACACGGCCTGTCGCAACATCGACGCCGTCGCCGACAAGTGCGCCTTTGTCAAGCGT
CACTGCGCCGACGTCGACGCCAGCCTCATCCCCTATCTCGAGCTCTACTACTGCACCCATCAGAGCGCGAGACCC
CTCTCCTTCTCCCTCCTCGTCGCCTGGCTCGGTCTGCTCTTTTCCACCATCGGCATCGCTGCCAGCGACTTCTTC
TGCGTCAACCTCGCCACCATCTCCGCCGTCCTCGGCCTGAGCCAGAGCCTCGCCGGCGTCACCTTTCTCGCCCTC
GGCAACGGCTCCCCCGATGTCTTCAGCACCTTTGCCGCCATGAGTTCAAACAGCCCCGGCATGGCCATAGGCGAG
CTCATCGGCGCTGCCAGCTTCATCGCCGGCGTCGTTGCCGGTTCCATGGCCCTCGTTCGCGAGTTCCGCGTCGAC
CGCAAGACGTACGCACGCGATATTTGCTTCTTCATCGTCGCCGTCGCCTTCACCATGGCCTTCCTGGCCGACGGC
AACCTTCACATCTGGGAGTGCTGTGTCATGATCGGCTATTACGCGCTCTACGTCATCACCGTCGTCGTCAGTCAC
TGGTACGATGTCAGGGCCAGGCGCGAGCTCCGGCGAGACACAGAGTCTCGCAGCCACGTCTATGTCATGGATGGT
CACGCTGAGGAGCTGGCGGGCGAGCCCTATCGAGACGACGACCGTTCGCCCTTGCCCGTCACCCCCGTCACTCTC
GAAGCCGGCTCGCTCGTTGATGACGACGGCCATCACGAACGGTTGGCAGCGGCCGAGGTGACGAATAATATGCGC
GTCGTGCGATCGAGCCATAAGCGGCCTCCGATCACGACTCCCATCCGTCCGAGTCTGGTGGGCGCTCTCGAATTC
CGCGCTGCTCTGGCCCAGCTCCAGCGCGAGAGCAACCTGCATCTCTCGCCCCTGCTGGTCCGGGGCCAGTCCCAG
TCTCGGCCCCTGCTGCGGCGTGGGACAACGTGCAATGCCCTGTTCGGGGGTAGCGACGACGGCACCGGTGTCTCG
ACTCCCGTGCCCAGCCTCGCACGCAGGGATCGCGCCCTGTCGTCGAGCGACATACCGGTCGCTTCCACCGTCGTC
CCCGCTGATCTCATGGACGCACGCCTCGGCAGTACGGGGTCTCGGTTTCTGACGCCCGAGGCGGCCCAGCCGGAG
CGGACGAATCCGTCGCCAACGCCCTCGTTGCCCGTCATAGCAGTCGAGCCACCCGACGAGACGAATCATGAACCG
TCGCGGGAATCCATCCCGAAGCTGAGGCTGGAGATACCGGGCCATTCGAGGAGTCCCAGTGCAACGTCGTCGCCT
GAAACGGCTTTCCCCCGCTACGTCGATCCGAGCGCGCTCGGAGACGACGACGTCCAGCCTCCGGCCCCTGTTTCG
GTCCGATGGTGGCCGTATCGGGTGCTTCCCCCGCCTGACGTCCTGCTGGCGACGCTGTTCCCGACCCTGCAGGGC
TGGCGGGAAAAGTCTTACTGGGATCGTTTACTCAGCGCGATATCGGTCCCCAGCATTTTCCTGCTGGTGATAACG
CTGCCCGTCGTGGACATGGAGGCGACCGAAGAAGCCACGATGGAGCGAGATCTCCTGTCCGATGGCCCGAGCTAT
GGTGCCATGGAAGGCTCGGCGCCGGCCATTTCCGTGATCCCTGCCGACGCCCAGGCCGAAACCGGCTGGGAAAAT
TATCGGTTGTCGCCGGCAGCGGACCCGTCGGCCGAAGCGATGGAAGGCGTCGCATCGAGAGGCTCCGTCATGTCT
GCCAAGGCGCCATCGGAGATACGGTCGGCGAGCAAGGGTAGCAAGGAGCCGCCGTCGTGGAACCGATGGCTAGTC
TGTGTTCAGCTCTTCAGCGGGCCGCTATTTTCGACGCTGATCCTGTGGGCCAACATGCGGGAGGACATGGGACGA
CCGGTGCGGGAGCTGGTGCGGATGGTGGCCTTTTCGTTGTTGCTGTCGGCCTTGCTGCTGGCAGTGGTGCTGATG
ACGACGACGGGCCAGAGGCGACCGCGGCTCCACTACCTGCTATGCTTCCTGGGCTTCGTTATCAGCGTCGCGTGG
ATATCGACGATCGCGGGCGAAGTGGTCGGGGTGCTCAAGGCCTTTGGCGTCATCCTGGGCATATCGGAGGCGCTG
CTGGGACTGACGGTGTTCGCAGCGGGCAACAGCATCGGAGATCTGGTGGCGGACATAACGGTCGCGCGACTGGGG
TATCCGGTCATGGCGCTGTAAGTCGATGGCGGCCCGCTCGGGGAGAGTTTCCGATGCTGACGGAGTACATACAAG
GTCTGCGTGCTTCGGAGGACCCATGCTCAACATCCTGCTGGGCATCGGCATCGGGGGCGTCATGATGATGATGAA
GCAGGCCAACAAGGAGCACGGGCAGCATCCGGGGGAGCCGATGCGATACGGCCCGTACAGGATGCAGATGGGAGC
GACGCTGTTCGTGTCGGGGGTGACGCTGCTGCTGATGCTGGTGGTGCTGGTGGTGCTTGTGCCGATGAACAAGTG
GATACTGAGCCGTCGGATCGGCTGGCTGGTGATTATGATGTGGGTTGTGAGCACGGCTGTGAGCGTCGTGGTCGA
GTTGACGGGTAAGTCGAGCGGGCTGGCGTCCGTCGACGTAGAATGGCTACCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail