Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|07146
Gene name
Locationscaffold_09:741138..743968
Strand-
Gene length (bp)2830
Transcript length (bp)2772
Coding sequence length (bp)2772
Protein length (aa) 924

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01699 Na_Ca_ex Sodium/calcium exchanger protein 1.2E-28 108 246
PF01699 Na_Ca_ex Sodium/calcium exchanger protein 8.8E-24 741 903

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0016021 integral component of membrane Yes
GO:0005575 cellular_component No
GO:0051179 localization No
GO:0008150 biological_process No
GO:0031224 intrinsic component of membrane No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0110165 cellular anatomical entity No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 28 0.45

Transmembrane Domains

Domain # Start End Length
1 12 29 17
2 100 122 22
3 129 151 22
4 173 195 22
5 208 230 22
6 235 252 17
7 560 579 19
8 670 692 22
9 705 727 22
10 737 759 22
11 766 788 22
12 803 825 22
13 855 877 22
14 887 909 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|07146
MLSNRSRPPSRPFVVALVALALLTAYSFLNRGPSPDPSSSSHDGSYPAHIRRHHHDDTACRNIDAVADKCAFVKR
HCADVDASLIPYLELYYCTHQSARPLSFSLLVAWLGLLFSTIGIAASDFFCVNLATISAVLGLSQSLAGVTFLAL
GNGSPDVFSTFAAMSSNSPGMAIGELIGAASFIAGVVAGSMALVREFRVDRKTYARDICFFIVAVAFTMAFLADG
NLHIWECCVMIGYYALYVITVVVSHWYDVRARRELRRDTESRSHVYVMDGHAEELAGEPYRDDDRSPLPVTPVTL
EAGSLVDDDGHHERLAAAEVTNNMRVVRSSHKRPPITTPIRPSLVGALEFRAALAQLQRESNLHLSPLLVRGQSQ
SRPLLRRGTTCNALFGGSDDGTGVSTPVPSLARRDRALSSSDIPVASTVVPADLMDARLGSTGSRFLTPEAAQPE
RTNPSPTPSLPVIAVEPPDETNHEPSRESIPKLRLEIPGHSRSPSATSSPETAFPRYVDPSALGDDDVQPPAPVS
VRWWPYRVLPPPDVLLATLFPTLQGWREKSYWDRLLSAISVPSIFLLVITLPVVDMEATEEATMERDLLSDGPSY
GAMEGSAPAISVIPADAQAETGWENYRLSPAADPSAEAMEGVASRGSVMSAKAPSEIRSASKGSKEPPSWNRWLV
CVQLFSGPLFSTLILWANMREDMGRPVRELVRMVAFSLLLSALLLAVVLMTTTGQRRPRLHYLLCFLGFVISVAW
ISTIAGEVVGVLKAFGVILGISEALLGLTVFAAGNSIGDLVADITVARLGYPVMALSACFGGPMLNILLGIGIGG
VMMMMKQANKEHGQHPGEPMRYGPYRMQMGATLFVSGVTLLLMLVVLVVLVPMNKWILSRRIGWLVIMMWVVSTA
VSVVVELTGKSSGLASVDVEWLP*
Coding >Ophcf2|07146
ATGCTCTCTAACCGCTCCAGACCCCCGTCACGCCCCTTTGTCGTCGCCCTCGTCGCCCTCGCCCTCCTGACGGCC
TATTCGTTCCTCAACCGAGGCCCTTCACCCGACCCGTCCTCCTCTTCCCATGATGGGTCTTATCCCGCCCATATC
CGCCGTCACCATCATGACGACACGGCCTGTCGCAACATCGACGCCGTCGCCGACAAGTGCGCCTTTGTCAAGCGT
CACTGCGCCGACGTCGACGCCAGCCTCATCCCCTATCTCGAGCTCTACTACTGCACCCATCAGAGCGCGAGACCC
CTCTCCTTCTCCCTCCTCGTCGCCTGGCTCGGTCTGCTCTTTTCCACCATCGGCATCGCTGCCAGCGACTTCTTC
TGCGTCAACCTCGCCACCATCTCCGCCGTCCTCGGCCTGAGCCAGAGCCTCGCCGGCGTCACCTTTCTCGCCCTC
GGCAACGGCTCCCCCGATGTCTTCAGCACCTTTGCCGCCATGAGTTCAAACAGCCCCGGCATGGCCATAGGCGAG
CTCATCGGCGCTGCCAGCTTCATCGCCGGCGTCGTTGCCGGTTCCATGGCCCTCGTTCGCGAGTTCCGCGTCGAC
CGCAAGACGTACGCACGCGATATTTGCTTCTTCATCGTCGCCGTCGCCTTCACCATGGCCTTCCTGGCCGACGGC
AACCTTCACATCTGGGAGTGCTGTGTCATGATCGGCTATTACGCGCTCTACGTCATCACCGTCGTCGTCAGTCAC
TGGTACGATGTCAGGGCCAGGCGCGAGCTCCGGCGAGACACAGAGTCTCGCAGCCACGTCTATGTCATGGATGGT
CACGCTGAGGAGCTGGCGGGCGAGCCCTATCGAGACGACGACCGTTCGCCCTTGCCCGTCACCCCCGTCACTCTC
GAAGCCGGCTCGCTCGTTGATGACGACGGCCATCACGAACGGTTGGCAGCGGCCGAGGTGACGAATAATATGCGC
GTCGTGCGATCGAGCCATAAGCGGCCTCCGATCACGACTCCCATCCGTCCGAGTCTGGTGGGCGCTCTCGAATTC
CGCGCTGCTCTGGCCCAGCTCCAGCGCGAGAGCAACCTGCATCTCTCGCCCCTGCTGGTCCGGGGCCAGTCCCAG
TCTCGGCCCCTGCTGCGGCGTGGGACAACGTGCAATGCCCTGTTCGGGGGTAGCGACGACGGCACCGGTGTCTCG
ACTCCCGTGCCCAGCCTCGCACGCAGGGATCGCGCCCTGTCGTCGAGCGACATACCGGTCGCTTCCACCGTCGTC
CCCGCTGATCTCATGGACGCACGCCTCGGCAGTACGGGGTCTCGGTTTCTGACGCCCGAGGCGGCCCAGCCGGAG
CGGACGAATCCGTCGCCAACGCCCTCGTTGCCCGTCATAGCAGTCGAGCCACCCGACGAGACGAATCATGAACCG
TCGCGGGAATCCATCCCGAAGCTGAGGCTGGAGATACCGGGCCATTCGAGGAGTCCCAGTGCAACGTCGTCGCCT
GAAACGGCTTTCCCCCGCTACGTCGATCCGAGCGCGCTCGGAGACGACGACGTCCAGCCTCCGGCCCCTGTTTCG
GTCCGATGGTGGCCGTATCGGGTGCTTCCCCCGCCTGACGTCCTGCTGGCGACGCTGTTCCCGACCCTGCAGGGC
TGGCGGGAAAAGTCTTACTGGGATCGTTTACTCAGCGCGATATCGGTCCCCAGCATTTTCCTGCTGGTGATAACG
CTGCCCGTCGTGGACATGGAGGCGACCGAAGAAGCCACGATGGAGCGAGATCTCCTGTCCGATGGCCCGAGCTAT
GGTGCCATGGAAGGCTCGGCGCCGGCCATTTCCGTGATCCCTGCCGACGCCCAGGCCGAAACCGGCTGGGAAAAT
TATCGGTTGTCGCCGGCAGCGGACCCGTCGGCCGAAGCGATGGAAGGCGTCGCATCGAGAGGCTCCGTCATGTCT
GCCAAGGCGCCATCGGAGATACGGTCGGCGAGCAAGGGTAGCAAGGAGCCGCCGTCGTGGAACCGATGGCTAGTC
TGTGTTCAGCTCTTCAGCGGGCCGCTATTTTCGACGCTGATCCTGTGGGCCAACATGCGGGAGGACATGGGACGA
CCGGTGCGGGAGCTGGTGCGGATGGTGGCCTTTTCGTTGTTGCTGTCGGCCTTGCTGCTGGCAGTGGTGCTGATG
ACGACGACGGGCCAGAGGCGACCGCGGCTCCACTACCTGCTATGCTTCCTGGGCTTCGTTATCAGCGTCGCGTGG
ATATCGACGATCGCGGGCGAAGTGGTCGGGGTGCTCAAGGCCTTTGGCGTCATCCTGGGCATATCGGAGGCGCTG
CTGGGACTGACGGTGTTCGCAGCGGGCAACAGCATCGGAGATCTGGTGGCGGACATAACGGTCGCGCGACTGGGG
TATCCGGTCATGGCGCTGTCTGCGTGCTTCGGAGGACCCATGCTCAACATCCTGCTGGGCATCGGCATCGGGGGC
GTCATGATGATGATGAAGCAGGCCAACAAGGAGCACGGGCAGCATCCGGGGGAGCCGATGCGATACGGCCCGTAC
AGGATGCAGATGGGAGCGACGCTGTTCGTGTCGGGGGTGACGCTGCTGCTGATGCTGGTGGTGCTGGTGGTGCTT
GTGCCGATGAACAAGTGGATACTGAGCCGTCGGATCGGCTGGCTGGTGATTATGATGTGGGTTGTGAGCACGGCT
GTGAGCGTCGTGGTCGAGTTGACGGGTAAGTCGAGCGGGCTGGCGTCCGTCGACGTAGAATGGCTACCCTAG
Transcript >Ophcf2|07146
ATGCTCTCTAACCGCTCCAGACCCCCGTCACGCCCCTTTGTCGTCGCCCTCGTCGCCCTCGCCCTCCTGACGGCC
TATTCGTTCCTCAACCGAGGCCCTTCACCCGACCCGTCCTCCTCTTCCCATGATGGGTCTTATCCCGCCCATATC
CGCCGTCACCATCATGACGACACGGCCTGTCGCAACATCGACGCCGTCGCCGACAAGTGCGCCTTTGTCAAGCGT
CACTGCGCCGACGTCGACGCCAGCCTCATCCCCTATCTCGAGCTCTACTACTGCACCCATCAGAGCGCGAGACCC
CTCTCCTTCTCCCTCCTCGTCGCCTGGCTCGGTCTGCTCTTTTCCACCATCGGCATCGCTGCCAGCGACTTCTTC
TGCGTCAACCTCGCCACCATCTCCGCCGTCCTCGGCCTGAGCCAGAGCCTCGCCGGCGTCACCTTTCTCGCCCTC
GGCAACGGCTCCCCCGATGTCTTCAGCACCTTTGCCGCCATGAGTTCAAACAGCCCCGGCATGGCCATAGGCGAG
CTCATCGGCGCTGCCAGCTTCATCGCCGGCGTCGTTGCCGGTTCCATGGCCCTCGTTCGCGAGTTCCGCGTCGAC
CGCAAGACGTACGCACGCGATATTTGCTTCTTCATCGTCGCCGTCGCCTTCACCATGGCCTTCCTGGCCGACGGC
AACCTTCACATCTGGGAGTGCTGTGTCATGATCGGCTATTACGCGCTCTACGTCATCACCGTCGTCGTCAGTCAC
TGGTACGATGTCAGGGCCAGGCGCGAGCTCCGGCGAGACACAGAGTCTCGCAGCCACGTCTATGTCATGGATGGT
CACGCTGAGGAGCTGGCGGGCGAGCCCTATCGAGACGACGACCGTTCGCCCTTGCCCGTCACCCCCGTCACTCTC
GAAGCCGGCTCGCTCGTTGATGACGACGGCCATCACGAACGGTTGGCAGCGGCCGAGGTGACGAATAATATGCGC
GTCGTGCGATCGAGCCATAAGCGGCCTCCGATCACGACTCCCATCCGTCCGAGTCTGGTGGGCGCTCTCGAATTC
CGCGCTGCTCTGGCCCAGCTCCAGCGCGAGAGCAACCTGCATCTCTCGCCCCTGCTGGTCCGGGGCCAGTCCCAG
TCTCGGCCCCTGCTGCGGCGTGGGACAACGTGCAATGCCCTGTTCGGGGGTAGCGACGACGGCACCGGTGTCTCG
ACTCCCGTGCCCAGCCTCGCACGCAGGGATCGCGCCCTGTCGTCGAGCGACATACCGGTCGCTTCCACCGTCGTC
CCCGCTGATCTCATGGACGCACGCCTCGGCAGTACGGGGTCTCGGTTTCTGACGCCCGAGGCGGCCCAGCCGGAG
CGGACGAATCCGTCGCCAACGCCCTCGTTGCCCGTCATAGCAGTCGAGCCACCCGACGAGACGAATCATGAACCG
TCGCGGGAATCCATCCCGAAGCTGAGGCTGGAGATACCGGGCCATTCGAGGAGTCCCAGTGCAACGTCGTCGCCT
GAAACGGCTTTCCCCCGCTACGTCGATCCGAGCGCGCTCGGAGACGACGACGTCCAGCCTCCGGCCCCTGTTTCG
GTCCGATGGTGGCCGTATCGGGTGCTTCCCCCGCCTGACGTCCTGCTGGCGACGCTGTTCCCGACCCTGCAGGGC
TGGCGGGAAAAGTCTTACTGGGATCGTTTACTCAGCGCGATATCGGTCCCCAGCATTTTCCTGCTGGTGATAACG
CTGCCCGTCGTGGACATGGAGGCGACCGAAGAAGCCACGATGGAGCGAGATCTCCTGTCCGATGGCCCGAGCTAT
GGTGCCATGGAAGGCTCGGCGCCGGCCATTTCCGTGATCCCTGCCGACGCCCAGGCCGAAACCGGCTGGGAAAAT
TATCGGTTGTCGCCGGCAGCGGACCCGTCGGCCGAAGCGATGGAAGGCGTCGCATCGAGAGGCTCCGTCATGTCT
GCCAAGGCGCCATCGGAGATACGGTCGGCGAGCAAGGGTAGCAAGGAGCCGCCGTCGTGGAACCGATGGCTAGTC
TGTGTTCAGCTCTTCAGCGGGCCGCTATTTTCGACGCTGATCCTGTGGGCCAACATGCGGGAGGACATGGGACGA
CCGGTGCGGGAGCTGGTGCGGATGGTGGCCTTTTCGTTGTTGCTGTCGGCCTTGCTGCTGGCAGTGGTGCTGATG
ACGACGACGGGCCAGAGGCGACCGCGGCTCCACTACCTGCTATGCTTCCTGGGCTTCGTTATCAGCGTCGCGTGG
ATATCGACGATCGCGGGCGAAGTGGTCGGGGTGCTCAAGGCCTTTGGCGTCATCCTGGGCATATCGGAGGCGCTG
CTGGGACTGACGGTGTTCGCAGCGGGCAACAGCATCGGAGATCTGGTGGCGGACATAACGGTCGCGCGACTGGGG
TATCCGGTCATGGCGCTGTCTGCGTGCTTCGGAGGACCCATGCTCAACATCCTGCTGGGCATCGGCATCGGGGGC
GTCATGATGATGATGAAGCAGGCCAACAAGGAGCACGGGCAGCATCCGGGGGAGCCGATGCGATACGGCCCGTAC
AGGATGCAGATGGGAGCGACGCTGTTCGTGTCGGGGGTGACGCTGCTGCTGATGCTGGTGGTGCTGGTGGTGCTT
GTGCCGATGAACAAGTGGATACTGAGCCGTCGGATCGGCTGGCTGGTGATTATGATGTGGGTTGTGAGCACGGCT
GTGAGCGTCGTGGTCGAGTTGACGGGTAAGTCGAGCGGGCTGGCGTCCGTCGACGTAGAATGGCTACCCTAG
Gene >Ophcf2|07146
ATGCTCTCTAACCGCTCCAGACCCCCGTCACGCCCCTTTGTCGTCGCCCTCGTCGCCCTCGCCCTCCTGACGGCC
TATTCGTTCCTCAACCGAGGCCCTTCACCCGACCCGTCCTCCTCTTCCCATGATGGGTCTTATCCCGCCCATATC
CGCCGTCACCATCATGACGACACGGCCTGTCGCAACATCGACGCCGTCGCCGACAAGTGCGCCTTTGTCAAGCGT
CACTGCGCCGACGTCGACGCCAGCCTCATCCCCTATCTCGAGCTCTACTACTGCACCCATCAGAGCGCGAGACCC
CTCTCCTTCTCCCTCCTCGTCGCCTGGCTCGGTCTGCTCTTTTCCACCATCGGCATCGCTGCCAGCGACTTCTTC
TGCGTCAACCTCGCCACCATCTCCGCCGTCCTCGGCCTGAGCCAGAGCCTCGCCGGCGTCACCTTTCTCGCCCTC
GGCAACGGCTCCCCCGATGTCTTCAGCACCTTTGCCGCCATGAGTTCAAACAGCCCCGGCATGGCCATAGGCGAG
CTCATCGGCGCTGCCAGCTTCATCGCCGGCGTCGTTGCCGGTTCCATGGCCCTCGTTCGCGAGTTCCGCGTCGAC
CGCAAGACGTACGCACGCGATATTTGCTTCTTCATCGTCGCCGTCGCCTTCACCATGGCCTTCCTGGCCGACGGC
AACCTTCACATCTGGGAGTGCTGTGTCATGATCGGCTATTACGCGCTCTACGTCATCACCGTCGTCGTCAGTCAC
TGGTACGATGTCAGGGCCAGGCGCGAGCTCCGGCGAGACACAGAGTCTCGCAGCCACGTCTATGTCATGGATGGT
CACGCTGAGGAGCTGGCGGGCGAGCCCTATCGAGACGACGACCGTTCGCCCTTGCCCGTCACCCCCGTCACTCTC
GAAGCCGGCTCGCTCGTTGATGACGACGGCCATCACGAACGGTTGGCAGCGGCCGAGGTGACGAATAATATGCGC
GTCGTGCGATCGAGCCATAAGCGGCCTCCGATCACGACTCCCATCCGTCCGAGTCTGGTGGGCGCTCTCGAATTC
CGCGCTGCTCTGGCCCAGCTCCAGCGCGAGAGCAACCTGCATCTCTCGCCCCTGCTGGTCCGGGGCCAGTCCCAG
TCTCGGCCCCTGCTGCGGCGTGGGACAACGTGCAATGCCCTGTTCGGGGGTAGCGACGACGGCACCGGTGTCTCG
ACTCCCGTGCCCAGCCTCGCACGCAGGGATCGCGCCCTGTCGTCGAGCGACATACCGGTCGCTTCCACCGTCGTC
CCCGCTGATCTCATGGACGCACGCCTCGGCAGTACGGGGTCTCGGTTTCTGACGCCCGAGGCGGCCCAGCCGGAG
CGGACGAATCCGTCGCCAACGCCCTCGTTGCCCGTCATAGCAGTCGAGCCACCCGACGAGACGAATCATGAACCG
TCGCGGGAATCCATCCCGAAGCTGAGGCTGGAGATACCGGGCCATTCGAGGAGTCCCAGTGCAACGTCGTCGCCT
GAAACGGCTTTCCCCCGCTACGTCGATCCGAGCGCGCTCGGAGACGACGACGTCCAGCCTCCGGCCCCTGTTTCG
GTCCGATGGTGGCCGTATCGGGTGCTTCCCCCGCCTGACGTCCTGCTGGCGACGCTGTTCCCGACCCTGCAGGGC
TGGCGGGAAAAGTCTTACTGGGATCGTTTACTCAGCGCGATATCGGTCCCCAGCATTTTCCTGCTGGTGATAACG
CTGCCCGTCGTGGACATGGAGGCGACCGAAGAAGCCACGATGGAGCGAGATCTCCTGTCCGATGGCCCGAGCTAT
GGTGCCATGGAAGGCTCGGCGCCGGCCATTTCCGTGATCCCTGCCGACGCCCAGGCCGAAACCGGCTGGGAAAAT
TATCGGTTGTCGCCGGCAGCGGACCCGTCGGCCGAAGCGATGGAAGGCGTCGCATCGAGAGGCTCCGTCATGTCT
GCCAAGGCGCCATCGGAGATACGGTCGGCGAGCAAGGGTAGCAAGGAGCCGCCGTCGTGGAACCGATGGCTAGTC
TGTGTTCAGCTCTTCAGCGGGCCGCTATTTTCGACGCTGATCCTGTGGGCCAACATGCGGGAGGACATGGGACGA
CCGGTGCGGGAGCTGGTGCGGATGGTGGCCTTTTCGTTGTTGCTGTCGGCCTTGCTGCTGGCAGTGGTGCTGATG
ACGACGACGGGCCAGAGGCGACCGCGGCTCCACTACCTGCTATGCTTCCTGGGCTTCGTTATCAGCGTCGCGTGG
ATATCGACGATCGCGGGCGAAGTGGTCGGGGTGCTCAAGGCCTTTGGCGTCATCCTGGGCATATCGGAGGCGCTG
CTGGGACTGACGGTGTTCGCAGCGGGCAACAGCATCGGAGATCTGGTGGCGGACATAACGGTCGCGCGACTGGGG
TATCCGGTCATGGCGCTGTAAGTCGATGGCGGCCCGCTCGGGGAGAGTTTCCGATGCTGACGGAGTACATACAAG
GTCTGCGTGCTTCGGAGGACCCATGCTCAACATCCTGCTGGGCATCGGCATCGGGGGCGTCATGATGATGATGAA
GCAGGCCAACAAGGAGCACGGGCAGCATCCGGGGGAGCCGATGCGATACGGCCCGTACAGGATGCAGATGGGAGC
GACGCTGTTCGTGTCGGGGGTGACGCTGCTGCTGATGCTGGTGGTGCTGGTGGTGCTTGTGCCGATGAACAAGTG
GATACTGAGCCGTCGGATCGGCTGGCTGGTGATTATGATGTGGGTTGTGAGCACGGCTGTGAGCGTCGTGGTCGA
GTTGACGGGTAAGTCGAGCGGGCTGGCGTCCGTCGACGTAGAATGGCTACCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail