Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|07132
Gene name
Locationscaffold_09:693459..696289
Strand+
Gene length (bp)2830
Transcript length (bp)2496
Coding sequence length (bp)2496
Protein length (aa) 832

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01846 FF FF domain 8.0E-09 187 236
PF01846 FF FF domain 4.6E-12 254 304
PF01846 FF FF domain 3.5E-09 400 452
PF00397 WW WW domain 1.6E-09 29 54
PF00397 WW WW domain 5.4E-07 69 95

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.2767 0.9388 0.0771 0.0518 0.0365 0.003 0.0191 0.0087 0.0038 0.001

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4277
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7011
Ophiocordyceps australis map64 (Brazil) OphauB2|2653
Ophiocordyceps camponoti-floridani Ophcf2|07132 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|7204
Ophiocordyceps kimflemingae Ophio5|3992
Ophiocordyceps subramaniannii Hirsu2|8741

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|07132
MNGFAASPPPGVPPGVPPGGPPGTPSTCWREHRTPDGRVYFYNSITKVTQWTKPEDLMTPAERSLANQPWKEYTA
EGGRKYWYNTETQQSSWEMPEVFRNALGAGENRSALPPPTTPSGPAANTSPSPASNAAINTAGNTGNTANTGGRQ
SFRDPVRNSRDSSDQRQLARAFVPATESAPEYATHEEAVAAFTKALRRHGVQHDWTWEQTIRAVAKDPQFRAIKK
PKVRRETFEKFCHDMVVQEKERAQERFAKLRADFQTMLKRNPEIKHYTRWKTARPMLEGETHFRATDDEAERRQL
FDEYIVELQKKHKEEQSAQRKAAIDAIRELLPKLDITAYTRWLDGQQIISKATQDDAKYKALTKCDILLKFQDHV
KALERALNAKKQHDKAMLYRQERRNRDGFRALLAELCEKQHIQAGSKWSKIYHLIAEDPRYLNMLGQPGPTPMEL
FWLRVEEEDLKIREDRNYAVDVLQDNHFELTPQTSIDEFLSVMRSDKRTAGLDEETLRVIYNRLLEKLAAKREDE
RHLDRHQRRALDDLRSHMRHLDPPIKLGDSWESVRPRLSSLAEFQAVGSEDAARYAFDRHMRRLRERPDEDHDRD
HRKNNRVSSDRDMPRRNRDRSRGERSHRGGRHPRRSRSQEPDPYEDDRRRAVAERERNHRKSAMAENVLSTGDRV
RLSPPPRRERDRDYRERDRGYERYGRGRRRSDEGAFAREREPRERDLDRERPFRRGVDSRSVEELNYGDDGPPPA
TSSRRRRPEEDDGPSRREQRDAKRIKREGSREREWPEQKIKREGSHERTPHRETRQRIRSPVPRKQMVDVRSGSE
EGEIEE*
Coding >Ophcf2|07132
ATGAACGGCTTCGCGGCCTCGCCTCCTCCGGGCGTGCCTCCAGGTGTGCCACCAGGCGGACCACCAGGCACCCCC
TCGACTTGCTGGCGAGAGCATCGCACGCCTGATGGACGCGTCTACTTCTACAACTCCATCACCAAGGTCACGCAG
TGGACCAAGCCTGAGGACTTGATGACCCCTGCTGAGCGCTCTCTTGCCAACCAGCCATGGAAAGAATACACGGCA
GAGGGCGGACGAAAGTATTGGTACAATACCGAAACTCAGCAAAGCTCGTGGGAGATGCCAGAGGTCTTCAGAAAC
GCCCTGGGCGCTGGCGAGAATCGAAGCGCTCTGCCGCCTCCGACCACCCCATCTGGCCCAGCTGCCAACACATCC
CCCTCTCCAGCCTCCAACGCAGCTATCAATACAGCTGGCAACACTGGCAACACGGCCAACACTGGTGGTCGTCAG
AGCTTCCGCGACCCAGTTCGCAACTCACGTGACTCGTCCGATCAACGCCAGCTCGCTCGAGCTTTTGTTCCTGCC
ACCGAAAGCGCGCCCGAGTATGCTACTCACGAAGAGGCCGTCGCTGCATTTACCAAGGCTCTGCGTCGTCATGGC
GTTCAGCATGACTGGACTTGGGAGCAGACCATCAGGGCCGTCGCCAAGGATCCCCAGTTTCGTGCCATCAAGAAG
CCCAAGGTCAGGCGCGAGACGTTTGAGAAGTTCTGCCACGACATGGTAGTTCAGGAGAAGGAGCGAGCCCAGGAG
AGATTCGCAAAGCTTCGTGCCGACTTCCAGACCATGCTCAAGCGCAACCCGGAGATTAAGCACTATACTCGTTGG
AAGACGGCCCGTCCCATGCTCGAAGGCGAGACTCATTTCCGCGCCACCGACGACGAGGCCGAGCGCCGGCAGCTC
TTTGACGAGTACATCGTCGAACTCCAGAAGAAGCACAAGGAGGAACAGTCTGCTCAGCGAAAGGCGGCGATTGAT
GCCATCCGGGAGCTTCTTCCCAAGCTCGACATCACTGCCTACACCCGTTGGCTCGATGGGCAGCAGATCATCTCC
AAGGCCACCCAGGACGACGCGAAATACAAAGCCCTCACCAAATGTGATATCCTGCTTAAGTTCCAGGATCACGTC
AAGGCTCTCGAGCGCGCGCTCAATGCGAAGAAGCAGCATGATAAGGCCATGCTGTATCGCCAGGAACGACGCAAC
CGAGACGGCTTCAGGGCTCTTCTGGCCGAACTCTGCGAAAAGCAGCACATCCAGGCCGGCTCCAAATGGAGTAAG
ATCTACCACCTCATTGCCGAAGATCCCCGATATCTCAACATGTTGGGGCAGCCCGGCCCCACCCCCATGGAGCTA
TTTTGGCTCCGGGTCGAGGAGGAGGATCTCAAGATTCGGGAGGATCGAAATTACGCTGTCGATGTTTTACAAGAC
AACCATTTCGAGTTGACGCCTCAAACGTCGATCGATGAGTTCCTGTCTGTCATGAGATCCGATAAACGCACGGCG
GGCCTTGACGAAGAAACCCTTCGTGTTATATATAACAGGCTTCTTGAGAAGCTGGCCGCCAAACGAGAGGACGAA
CGACACCTTGACCGCCATCAACGCCGTGCGCTCGACGACCTGCGTTCGCACATGAGACACCTTGATCCGCCCATC
AAGCTCGGAGATAGCTGGGAGAGCGTGCGTCCTCGTCTCTCGAGCTTGGCCGAGTTCCAGGCCGTCGGTTCCGAG
GATGCCGCTCGATATGCTTTCGACAGGCACATGCGCCGCCTGAGGGAGAGGCCCGACGAGGATCACGATCGGGAC
CATCGCAAGAACAACCGCGTTTCGAGTGATCGAGACATGCCTCGCCGTAATAGGGATCGGTCTAGAGGCGAGAGA
TCTCATCGAGGCGGCCGCCACCCTCGACGCAGCCGAAGTCAGGAACCGGATCCTTACGAGGACGACAGACGACGT
GCGGTCGCAGAGAGGGAGCGCAACCACCGCAAGTCTGCCATGGCCGAGAATGTCCTGTCGACTGGTGATCGCGTG
CGTCTTAGCCCGCCGCCGCGACGCGAGCGCGACCGTGATTATCGAGAGCGAGACCGCGGATACGAACGCTACGGT
CGAGGACGCCGTCGCAGCGACGAAGGAGCTTTTGCCCGCGAGCGTGAGCCCCGTGAGCGTGACCTCGATCGTGAG
CGGCCTTTCCGTCGTGGCGTCGACTCGCGTTCCGTCGAGGAGCTCAACTATGGAGACGATGGACCTCCGCCGGCT
ACCTCCTCCCGTCGCCGCCGCCCTGAGGAGGATGATGGACCGTCTCGCCGCGAGCAGAGAGACGCCAAGAGAATC
AAGCGAGAGGGATCCCGCGAGCGTGAATGGCCCGAACAGAAGATCAAGCGAGAGGGATCCCACGAGCGTACTCCT
CATCGTGAAACCCGCCAGCGGATCCGATCCCCGGTGCCTCGCAAACAGATGGTTGACGTCAGAAGCGGAAGCGAA
GAAGGCGAGATAGAGGAGTGA
Transcript >Ophcf2|07132
ATGAACGGCTTCGCGGCCTCGCCTCCTCCGGGCGTGCCTCCAGGTGTGCCACCAGGCGGACCACCAGGCACCCCC
TCGACTTGCTGGCGAGAGCATCGCACGCCTGATGGACGCGTCTACTTCTACAACTCCATCACCAAGGTCACGCAG
TGGACCAAGCCTGAGGACTTGATGACCCCTGCTGAGCGCTCTCTTGCCAACCAGCCATGGAAAGAATACACGGCA
GAGGGCGGACGAAAGTATTGGTACAATACCGAAACTCAGCAAAGCTCGTGGGAGATGCCAGAGGTCTTCAGAAAC
GCCCTGGGCGCTGGCGAGAATCGAAGCGCTCTGCCGCCTCCGACCACCCCATCTGGCCCAGCTGCCAACACATCC
CCCTCTCCAGCCTCCAACGCAGCTATCAATACAGCTGGCAACACTGGCAACACGGCCAACACTGGTGGTCGTCAG
AGCTTCCGCGACCCAGTTCGCAACTCACGTGACTCGTCCGATCAACGCCAGCTCGCTCGAGCTTTTGTTCCTGCC
ACCGAAAGCGCGCCCGAGTATGCTACTCACGAAGAGGCCGTCGCTGCATTTACCAAGGCTCTGCGTCGTCATGGC
GTTCAGCATGACTGGACTTGGGAGCAGACCATCAGGGCCGTCGCCAAGGATCCCCAGTTTCGTGCCATCAAGAAG
CCCAAGGTCAGGCGCGAGACGTTTGAGAAGTTCTGCCACGACATGGTAGTTCAGGAGAAGGAGCGAGCCCAGGAG
AGATTCGCAAAGCTTCGTGCCGACTTCCAGACCATGCTCAAGCGCAACCCGGAGATTAAGCACTATACTCGTTGG
AAGACGGCCCGTCCCATGCTCGAAGGCGAGACTCATTTCCGCGCCACCGACGACGAGGCCGAGCGCCGGCAGCTC
TTTGACGAGTACATCGTCGAACTCCAGAAGAAGCACAAGGAGGAACAGTCTGCTCAGCGAAAGGCGGCGATTGAT
GCCATCCGGGAGCTTCTTCCCAAGCTCGACATCACTGCCTACACCCGTTGGCTCGATGGGCAGCAGATCATCTCC
AAGGCCACCCAGGACGACGCGAAATACAAAGCCCTCACCAAATGTGATATCCTGCTTAAGTTCCAGGATCACGTC
AAGGCTCTCGAGCGCGCGCTCAATGCGAAGAAGCAGCATGATAAGGCCATGCTGTATCGCCAGGAACGACGCAAC
CGAGACGGCTTCAGGGCTCTTCTGGCCGAACTCTGCGAAAAGCAGCACATCCAGGCCGGCTCCAAATGGAGTAAG
ATCTACCACCTCATTGCCGAAGATCCCCGATATCTCAACATGTTGGGGCAGCCCGGCCCCACCCCCATGGAGCTA
TTTTGGCTCCGGGTCGAGGAGGAGGATCTCAAGATTCGGGAGGATCGAAATTACGCTGTCGATGTTTTACAAGAC
AACCATTTCGAGTTGACGCCTCAAACGTCGATCGATGAGTTCCTGTCTGTCATGAGATCCGATAAACGCACGGCG
GGCCTTGACGAAGAAACCCTTCGTGTTATATATAACAGGCTTCTTGAGAAGCTGGCCGCCAAACGAGAGGACGAA
CGACACCTTGACCGCCATCAACGCCGTGCGCTCGACGACCTGCGTTCGCACATGAGACACCTTGATCCGCCCATC
AAGCTCGGAGATAGCTGGGAGAGCGTGCGTCCTCGTCTCTCGAGCTTGGCCGAGTTCCAGGCCGTCGGTTCCGAG
GATGCCGCTCGATATGCTTTCGACAGGCACATGCGCCGCCTGAGGGAGAGGCCCGACGAGGATCACGATCGGGAC
CATCGCAAGAACAACCGCGTTTCGAGTGATCGAGACATGCCTCGCCGTAATAGGGATCGGTCTAGAGGCGAGAGA
TCTCATCGAGGCGGCCGCCACCCTCGACGCAGCCGAAGTCAGGAACCGGATCCTTACGAGGACGACAGACGACGT
GCGGTCGCAGAGAGGGAGCGCAACCACCGCAAGTCTGCCATGGCCGAGAATGTCCTGTCGACTGGTGATCGCGTG
CGTCTTAGCCCGCCGCCGCGACGCGAGCGCGACCGTGATTATCGAGAGCGAGACCGCGGATACGAACGCTACGGT
CGAGGACGCCGTCGCAGCGACGAAGGAGCTTTTGCCCGCGAGCGTGAGCCCCGTGAGCGTGACCTCGATCGTGAG
CGGCCTTTCCGTCGTGGCGTCGACTCGCGTTCCGTCGAGGAGCTCAACTATGGAGACGATGGACCTCCGCCGGCT
ACCTCCTCCCGTCGCCGCCGCCCTGAGGAGGATGATGGACCGTCTCGCCGCGAGCAGAGAGACGCCAAGAGAATC
AAGCGAGAGGGATCCCGCGAGCGTGAATGGCCCGAACAGAAGATCAAGCGAGAGGGATCCCACGAGCGTACTCCT
CATCGTGAAACCCGCCAGCGGATCCGATCCCCGGTGCCTCGCAAACAGATGGTTGACGTCAGAAGCGGAAGCGAA
GAAGGCGAGATAGAGGAGTGA
Gene >Ophcf2|07132
ATGAACGGCTTCGCGGCCTCGCCTCCTCCGGGCGTGCCTCCAGGTGTGCCACCAGGCGGACCACCAGGCACCCCC
TCGACTTGCTGGCGAGAGCATCGCACGCCTGATGGACGCGTCTACTTCTACAACTCCATCACCAAGGTCACGCAG
TGGACCAAGCCTGAGGACTTGATGACCCCTGCTGAGGTTGGTATTCCTTCCCTGTCTAGCTCAGCGTCGCTGAAC
ACTGTTTTTCCGCAGCGCTCTCTTGCCAACCAGCCATGGAAAGAATACACGGCAGAGGGCGGACGAAAGTATTGG
TACAATACCGAAACTCAGCAAAGCTCGTGGGAGATGCCAGAGGTCTTCAGAAACGCCCTGGGCGCTGGCGAGAAT
CGAAGCGCTCTGCCGCCTCCGACCACCCCATCTGGCCCAGCTGCCAACACATCCCCCTCTCCAGCCTCCAACGCA
GCTATCAATACAGCTGGCAACACTGGCAACACGGCCAACACTGGTGGTCGTCAGAGCTTCCGCGACCCAGTTCGC
AACTCACGTGACTCGTCCGATCAACGCCAGCTCGCTCGAGCTTTTGTTCCTGCCACCGAAAGCGCGCCCGAGTAT
GCTACTCACGAAGAGGCCGTCGCTGCATTTACCAAGGCTCTGCGTCGTCATGGCGTTCAGCATGACTGGACTTGG
GAGCAGACCATCAGGGCCGTCGCCAAGGATCCCCAGTTTCGTGCCATCAAGAAGCCCAAGGTCAGGCGCGAGACG
TTTGAGAAGTTCTGCCACGACATGGTAGTTCAGGAGAAGGAGCGAGCCCAGGAGAGATTCGCAAAGCTTCGTGCC
GACTTCCAGACCATGCTCAAGCGCAACCCGGAGATTAAGCACTATACTCGTTGGAAGACGGCCCGTCCCATGCTC
GAAGGCGAGACTCATTTCCGCGCCACCGACGACGAGGCCGAGCGCCGGCAGCTCTTTGACGAGTACATCGTCGAA
CTCCAGAAGAAGCACAAGGAGGAACAGTCTGCTCAGCGAAAGGCGGCGATTGATGCCATCCGGGAGCTTCTTCCC
AAGCTCGACATCACTGCCTACACCCGTTGGCTCGATGGGCAGCAGATCATCTCCAAGGCCACCCAGGACGACGCG
AAATACAAAGCCCTCACCAAATGTGATATCCTGCTTAAGTTCCAGGATCACGTCAAGGCTCTCGAGCGCGCGCTC
AATGCGAAGAAGCAGCATGATAAGGCCATGCTGTATCGCCAGGAACGACGCAACCGAGACGGCTTCAGGGCTCTT
CTGGCCGAACTCTGCGAAAAGCAGCACATCCAGGCCGGCTCCAAATGGAGTAAGATCTACCACCTCATTGCCGAA
GATCCCCGATATCTCAACATGTTGGGGCAGCCCGGCCCCACCCCCATGGAGCTATTTTGGCTCCGGGTCGAGGAG
GAGGATCTCAAGATTCGGGAGGATCGAAATTACGCTGTCGATGTTTTACAAGTAGGGCTCTAACCCATTTTCTTG
CGTTTCTATTTTCTTTTGTGGTTTCCCGGCTGTGTTGTTTTGTGACATGACTATTATTGTATCTTCCCGCCATGT
CTTCATTCCGCGGCATCGCCCGTTCTCTCTTCAGAACTCCGCGCTGACACTGGGCTGGCAAGGACAACCATTTCG
AGTTGACGCCTCAAACGTCGATCGATGAGTTCCTGTCTGTCATGAGATCCGATAAACGCACGGCGGGCCTTGACG
AAGAAACCCTTCGTGTTATATATAACAGGGTAATTACTCCACCAGAGCTGATTTTCCCCCCCCCGGAAGTACGAC
TAACAATGGATGTCAAGCTTCTTGAGAAGCTGGCCGCCAAACGAGAGGACGAACGACACCTTGACCGCCATCAAC
GCCGTGCGCTCGACGACCTGCGTTCGCACATGAGACACCTTGATCCGCCCATCAAGCTCGGAGATAGCTGGGAGA
GCGTGCGTCCTCGTCTCTCGAGCTTGGCCGAGTTCCAGGCCGTCGGTTCCGAGGATGCCGCTCGATATGCTTTCG
ACAGGCACATGCGCCGCCTGAGGGAGAGGCCCGACGAGGATCACGATCGGGACCATCGCAAGAACAACCGCGTTT
CGAGTGATCGAGACATGCCTCGCCGTAATAGGGATCGGTCTAGAGGCGAGAGATCTCATCGAGGCGGCCGCCACC
CTCGACGCAGCCGAAGTCAGGAACCGGATCCTTACGAGGACGACAGACGACGTGCGGTCGCAGAGAGGGAGCGCA
ACCACCGCAAGTCTGCCATGGCCGAGAATGTCCTGTCGACTGGTGATCGCGTGCGTCTTAGCCCGCCGCCGCGAC
GCGAGCGCGACCGTGATTATCGAGAGCGAGACCGCGGATACGAACGCTACGGTCGAGGACGCCGTCGCAGCGACG
AAGGAGCTTTTGCCCGCGAGCGTGAGCCCCGTGAGCGTGACCTCGATCGTGAGCGGCCTTTCCGTCGTGGCGTCG
ACTCGCGTTCCGTCGAGGAGCTCAACTATGGAGACGATGGACCTCCGCCGGCTACCTCCTCCCGTCGCCGCCGCC
CTGAGGAGGATGATGGACCGTCTCGCCGCGAGCAGAGAGACGCCAAGGTACGTGATTCTTCTTGATTGTCTCCAT
GTTATGCGCTGCTTACAGGCCCGGATAGAGAATCAAGCGAGAGGGATCCCGCGAGCGTGAATGGCCCGAACAGAA
GATCAAGCGAGAGGGATCCCACGAGCGTACTCCTCATCGTGAAACCCGCCAGCGGATCCGATCCCCGGTGCCTCG
CAAACAGATGGTTGACGTCAGAAGCGGAAGCGAAGAAGGCGAGATAGAGGAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail