Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|07130
Gene name
Locationscaffold_09:687563..690389
Strand+
Gene length (bp)2826
Transcript length (bp)2577
Coding sequence length (bp)2577
Protein length (aa) 859

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08639 SLD3 DNA replication regulator SLD3 5.4E-151 274 797

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.2887 0.9125 0.0838 0.0563 0.0278 0.0061 0.0144 0.0158 0.0106 0.0064

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1709
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7013
Ophiocordyceps australis map64 (Brazil) OphauB2|2655
Ophiocordyceps camponoti-floridani Ophcf2|07130 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6467
Ophiocordyceps kimflemingae Ophio5|159
Ophiocordyceps subramaniannii Hirsu2|1510

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|07130
MSGTSADGTDASRTRAILTPSSDGIDDGKRRPDAGAMEELLRPSVAVKPHPPQLHVQPRLLLPLMLLPREHLPLA
SIEFGASDRDMPPSRLFESRVKMLDLESRFGASTSVLVARNETRGTVHVLERQGSDEGLYVMCQLGSWVDLAALA
ARATAVAWERLRALTSQHRPGGEGNAPLAAPPLFKESGRKRAAVEAVQSLVRKRVRSRSVTTVNDAGRHVLASVT
GNQARLRTPDRTTKPEREEAEIMLADIAPALDLDGMASTAQPPATAEAIFDGIRLQYSEALYKSMGSLAYFVKGP
LSRARSAFHIDLDTSLDMSDLIDFLKSLILTTVQIDTKYRDTIPDLIAKVNNFDGLDENSSKRKRRPRKMKIGKS
GLYPHEDESIRKWWASKQQPGDDQSSSSMATAQLKSHVSLLRTRETQLQMIIALEILALEPLKAGEDVLPRLPEA
ESNGEPTTPVPAPRKRSRLNLQLLIDVHADRLTIWQSIASDEQLLLGESQVSRQPDGQLQPRTSAEPLRDFCVDI
IVPFFSSRLPEICDGINRKLGGPLLLSPPKPKPSRTAPKKREQKPGTAAKRPTPVRSQRTLQRALSAEQQHRRSL
SRGPSNAIALLRSATTASLVNVKREGSEPTSARNLKEAPRLAPAWKRPPLSHSASAPHLVAGSKESRKALVEAEL
KDAISALRKPNRDVVGKAMAEADERRLLSAKKAKKPPSRAPVVVKATPATTRFTDVLAPNRHSTGDHAPPFGVQH
SPVLPSSDGKRIIPSTGQRPSHRDAFSIVGASSPPAADFVVDDTPMKPPARPCFIRRFVGEALAVPAPPSSPLAG
AGRGELSVLDTPVRDSGGGVLGVDLSSAWVGGR*
Coding >Ophcf2|07130
ATGTCCGGGACGTCGGCTGACGGTACGGACGCGTCGCGTACGCGCGCCATCCTGACGCCCTCGTCTGATGGCATC
GATGACGGCAAGAGGAGGCCTGATGCTGGGGCCATGGAGGAGCTGCTGCGGCCGTCGGTGGCTGTCAAGCCGCAT
CCTCCGCAGCTACACGTCCAGCCACGCCTTCTACTGCCCTTGATGCTTCTACCGCGAGAGCATCTGCCGCTGGCG
AGCATCGAATTCGGGGCTTCGGATCGGGATATGCCGCCTTCGCGACTGTTTGAGTCTCGCGTCAAGATGCTCGAT
CTCGAGAGTCGGTTTGGTGCTTCGACTAGTGTTCTCGTTGCTCGGAACGAGACTCGCGGTACTGTTCATGTTCTG
GAGCGTCAGGGGAGCGATGAGGGATTATACGTCATGTGTCAGTTGGGTTCGTGGGTTGATCTCGCAGCGTTGGCG
GCTAGGGCGACGGCCGTTGCGTGGGAGCGGCTCCGGGCCCTGACGAGTCAACACCGGCCCGGGGGGGAGGGAAAC
GCCCCATTAGCTGCGCCTCCGTTGTTCAAGGAGAGTGGGAGGAAGCGTGCTGCCGTGGAGGCTGTCCAGTCTCTG
GTCAGGAAGCGGGTGAGGTCTCGGTCTGTCACGACGGTCAATGATGCGGGTCGTCATGTCCTGGCGTCGGTTACC
GGGAATCAAGCCCGTCTTCGGACGCCGGATCGTACGACGAAGCCGGAGAGGGAGGAGGCAGAAATCATGCTTGCC
GATATCGCCCCGGCCCTGGACCTGGATGGGATGGCCTCCACGGCACAGCCTCCGGCTACGGCTGAGGCAATCTTT
GACGGCATCCGCTTGCAGTATTCTGAAGCTCTTTACAAATCCATGGGGTCGCTGGCGTACTTTGTAAAGGGACCT
TTGTCGCGGGCACGGTCGGCCTTCCATATTGATCTCGACACGAGTCTGGACATGTCCGATCTGATCGACTTTCTC
AAAAGTTTAATACTTACCACGGTGCAGATCGACACGAAATACCGCGACACGATCCCCGACCTCATAGCAAAGGTC
AACAACTTTGACGGCTTGGACGAGAACAGCAGCAAGAGGAAGCGTCGGCCTCGGAAGATGAAGATTGGCAAGTCG
GGCCTCTACCCGCACGAAGATGAAAGCATCCGGAAATGGTGGGCATCGAAGCAGCAGCCGGGCGATGACCAGAGC
AGCAGCTCGATGGCGACGGCTCAGCTCAAGTCGCACGTATCGCTGCTACGCACCAGGGAGACGCAGCTGCAAATG
ATTATCGCGCTTGAGATCTTGGCGCTCGAGCCGCTCAAGGCCGGCGAAGACGTTCTGCCGCGGCTGCCTGAGGCC
GAGTCGAACGGGGAGCCGACGACGCCGGTGCCGGCGCCTAGGAAGCGCAGCAGGCTCAATCTCCAGCTGCTGATT
GACGTTCATGCCGATCGCCTTACTATCTGGCAGTCGATTGCTTCGGATGAGCAGCTTTTGCTGGGGGAGTCGCAG
GTTTCGCGACAGCCTGATGGGCAGCTTCAGCCGAGGACGTCGGCGGAGCCCCTGAGGGACTTTTGCGTTGACATT
ATTGTACCTTTCTTCTCTTCCCGTCTGCCGGAAATCTGCGACGGGATCAACCGCAAGCTCGGCGGACCGCTACTT
CTCTCACCCCCAAAGCCCAAGCCATCGCGGACGGCGCCCAAGAAGCGAGAGCAGAAGCCCGGAACGGCAGCCAAG
CGGCCGACGCCCGTCAGGTCGCAGAGGACGCTGCAGCGGGCGCTATCAGCCGAGCAGCAGCACCGCAGGAGTCTC
TCTCGCGGGCCCAGCAACGCCATCGCCCTCTTGCGATCCGCTACCACGGCTTCGCTCGTCAATGTCAAGAGGGAG
GGTAGCGAGCCGACGTCCGCGAGGAACTTGAAGGAAGCGCCGAGGCTGGCGCCGGCGTGGAAGAGGCCGCCTTTG
TCGCACAGCGCGAGTGCTCCTCACTTGGTCGCTGGCTCTAAGGAGAGTCGGAAGGCCTTGGTTGAGGCTGAGCTC
AAGGACGCCATCTCGGCGTTGAGGAAGCCTAATCGTGATGTTGTTGGCAAGGCTATGGCTGAGGCTGATGAGCGT
CGTCTTCTGTCGGCCAAGAAAGCCAAGAAACCGCCGTCTCGAGCCCCCGTCGTCGTCAAGGCAACGCCAGCAACA
ACTCGCTTCACCGACGTCCTCGCCCCAAACCGTCACAGCACAGGCGATCACGCTCCCCCCTTCGGCGTACAACAT
TCGCCAGTCCTCCCCTCAAGCGACGGCAAACGCATCATCCCATCGACGGGACAACGCCCAAGTCACAGAGACGCC
TTTTCCATCGTCGGCGCCTCGTCCCCGCCCGCGGCCGACTTTGTCGTCGACGACACGCCCATGAAGCCGCCTGCC
AGACCGTGTTTCATCCGTCGGTTTGTCGGTGAGGCTCTTGCTGTGCCGGCGCCGCCTTCTTCGCCTCTTGCTGGT
GCGGGGAGGGGGGAGTTGTCGGTTTTGGACACGCCTGTTAGGGATTCGGGAGGGGGTGTGTTGGGGGTCGATTTA
TCGTCGGCTTGGGTGGGAGGACGATGA
Transcript >Ophcf2|07130
ATGTCCGGGACGTCGGCTGACGGTACGGACGCGTCGCGTACGCGCGCCATCCTGACGCCCTCGTCTGATGGCATC
GATGACGGCAAGAGGAGGCCTGATGCTGGGGCCATGGAGGAGCTGCTGCGGCCGTCGGTGGCTGTCAAGCCGCAT
CCTCCGCAGCTACACGTCCAGCCACGCCTTCTACTGCCCTTGATGCTTCTACCGCGAGAGCATCTGCCGCTGGCG
AGCATCGAATTCGGGGCTTCGGATCGGGATATGCCGCCTTCGCGACTGTTTGAGTCTCGCGTCAAGATGCTCGAT
CTCGAGAGTCGGTTTGGTGCTTCGACTAGTGTTCTCGTTGCTCGGAACGAGACTCGCGGTACTGTTCATGTTCTG
GAGCGTCAGGGGAGCGATGAGGGATTATACGTCATGTGTCAGTTGGGTTCGTGGGTTGATCTCGCAGCGTTGGCG
GCTAGGGCGACGGCCGTTGCGTGGGAGCGGCTCCGGGCCCTGACGAGTCAACACCGGCCCGGGGGGGAGGGAAAC
GCCCCATTAGCTGCGCCTCCGTTGTTCAAGGAGAGTGGGAGGAAGCGTGCTGCCGTGGAGGCTGTCCAGTCTCTG
GTCAGGAAGCGGGTGAGGTCTCGGTCTGTCACGACGGTCAATGATGCGGGTCGTCATGTCCTGGCGTCGGTTACC
GGGAATCAAGCCCGTCTTCGGACGCCGGATCGTACGACGAAGCCGGAGAGGGAGGAGGCAGAAATCATGCTTGCC
GATATCGCCCCGGCCCTGGACCTGGATGGGATGGCCTCCACGGCACAGCCTCCGGCTACGGCTGAGGCAATCTTT
GACGGCATCCGCTTGCAGTATTCTGAAGCTCTTTACAAATCCATGGGGTCGCTGGCGTACTTTGTAAAGGGACCT
TTGTCGCGGGCACGGTCGGCCTTCCATATTGATCTCGACACGAGTCTGGACATGTCCGATCTGATCGACTTTCTC
AAAAGTTTAATACTTACCACGGTGCAGATCGACACGAAATACCGCGACACGATCCCCGACCTCATAGCAAAGGTC
AACAACTTTGACGGCTTGGACGAGAACAGCAGCAAGAGGAAGCGTCGGCCTCGGAAGATGAAGATTGGCAAGTCG
GGCCTCTACCCGCACGAAGATGAAAGCATCCGGAAATGGTGGGCATCGAAGCAGCAGCCGGGCGATGACCAGAGC
AGCAGCTCGATGGCGACGGCTCAGCTCAAGTCGCACGTATCGCTGCTACGCACCAGGGAGACGCAGCTGCAAATG
ATTATCGCGCTTGAGATCTTGGCGCTCGAGCCGCTCAAGGCCGGCGAAGACGTTCTGCCGCGGCTGCCTGAGGCC
GAGTCGAACGGGGAGCCGACGACGCCGGTGCCGGCGCCTAGGAAGCGCAGCAGGCTCAATCTCCAGCTGCTGATT
GACGTTCATGCCGATCGCCTTACTATCTGGCAGTCGATTGCTTCGGATGAGCAGCTTTTGCTGGGGGAGTCGCAG
GTTTCGCGACAGCCTGATGGGCAGCTTCAGCCGAGGACGTCGGCGGAGCCCCTGAGGGACTTTTGCGTTGACATT
ATTGTACCTTTCTTCTCTTCCCGTCTGCCGGAAATCTGCGACGGGATCAACCGCAAGCTCGGCGGACCGCTACTT
CTCTCACCCCCAAAGCCCAAGCCATCGCGGACGGCGCCCAAGAAGCGAGAGCAGAAGCCCGGAACGGCAGCCAAG
CGGCCGACGCCCGTCAGGTCGCAGAGGACGCTGCAGCGGGCGCTATCAGCCGAGCAGCAGCACCGCAGGAGTCTC
TCTCGCGGGCCCAGCAACGCCATCGCCCTCTTGCGATCCGCTACCACGGCTTCGCTCGTCAATGTCAAGAGGGAG
GGTAGCGAGCCGACGTCCGCGAGGAACTTGAAGGAAGCGCCGAGGCTGGCGCCGGCGTGGAAGAGGCCGCCTTTG
TCGCACAGCGCGAGTGCTCCTCACTTGGTCGCTGGCTCTAAGGAGAGTCGGAAGGCCTTGGTTGAGGCTGAGCTC
AAGGACGCCATCTCGGCGTTGAGGAAGCCTAATCGTGATGTTGTTGGCAAGGCTATGGCTGAGGCTGATGAGCGT
CGTCTTCTGTCGGCCAAGAAAGCCAAGAAACCGCCGTCTCGAGCCCCCGTCGTCGTCAAGGCAACGCCAGCAACA
ACTCGCTTCACCGACGTCCTCGCCCCAAACCGTCACAGCACAGGCGATCACGCTCCCCCCTTCGGCGTACAACAT
TCGCCAGTCCTCCCCTCAAGCGACGGCAAACGCATCATCCCATCGACGGGACAACGCCCAAGTCACAGAGACGCC
TTTTCCATCGTCGGCGCCTCGTCCCCGCCCGCGGCCGACTTTGTCGTCGACGACACGCCCATGAAGCCGCCTGCC
AGACCGTGTTTCATCCGTCGGTTTGTCGGTGAGGCTCTTGCTGTGCCGGCGCCGCCTTCTTCGCCTCTTGCTGGT
GCGGGGAGGGGGGAGTTGTCGGTTTTGGACACGCCTGTTAGGGATTCGGGAGGGGGTGTGTTGGGGGTCGATTTA
TCGTCGGCTTGGGTGGGAGGACGATGA
Gene >Ophcf2|07130
ATGTCCGGGACGTCGGCTGACGGTACGGACGCGTCGCGTACGCGCGCCATCCTGACGCCCTCGTCTGATGGCATC
GATGACGGCAAGAGGAGGCCTGATGCTGGGGCCATGGAGGAGCTGCTGCGGCCGTCGGTGGCTGTCAAGGTCGGC
GAATCGAATCGAACTTGTGTGCGTGAGAGACTGGACTGACTTTGGCGATAGCCGCATCCTCCGCAGCTACACGTC
CAGCCACGCCTTCTACTGCCCTTGATGCTTCTACCGCGAGAGCATCTGCCGCTGGCGAGCATCGAATTCGGGGCT
TCGGATCGGGATATGCCGCCTTCGCGACTGTTTGAGTCTCGCGTCAAGATGCTCGATCTCGAGAGTCGGTTTGGT
GCTTCGACTAGTGTTCTCGTTGCTCGGAACGAGACTCGCGGTACTGTTCATGTTCTGGAGCGTCAGGGGAGCGAT
GAGGGATTATACGTCATGTGTCAGTTGGGTTCGTGGGTTGATCTCGCAGCGTTGGCGGCTAGGGCGACGGCCGTT
GCGTGGGAGCGGCTCCGGGCCCTGACGAGTCAACACCGGCCCGGGGGGGAGGGAAACGCCCCATTAGCTGCGCCT
CCGTTGTTCAAGGAGAGTGGGAGGAAGCGTGCTGCCGTGGAGGCTGTCCAGTCTCTGGTCAGGAAGCGGGTGAGG
TCTCGGTCTGTCACGACGGTCAATGATGCGGGTCGTCATGTCCTGGCGTCGGTTACCGGGAATCAAGCCCGTCTT
CGGACGCCGGATCGTACGACGAAGCCGGAGAGGGAGGAGGCAGAAATCATGCTTGCCGATATCGCCCCGGCCCTG
GACCTGGATGGGATGGCCTCCACGGCACAGCCTCCGGCTACGGCTGAGGCAATCTTTGACGGCATCCGCTTGCAG
TATTCTGAAGCTCTTTACAAATCCATGGTGGGTTCACTCGACTACGTTTCACGTTGGTTCTTTCGCTGACAAGAT
TTAGGGGTCGCTGGCGTACTTTGTAAAGGGACCTTTGTCGCGGGCACGGTCGGCCTTCCATATTGATCTCGACAC
GAGTCTGGACATGTCCGATCTGATCGACTTTCTCAAAAGTTTAATACTTACCACGGTGCAGATCGACACGAAATA
CCGCGACACGATCCCCGACCTCATAGCAAAGGTCAACAACTTTGACGGCTTGGACGAGAACAGCAGCAAGAGGAA
GCGTCGGCCTCGGAAGATGAAGATTGGCAAGTCGGGCCTCTACCCGCACGAAGATGAAAGCATCCGGAAATGGTG
GGCATCGAAGCAGCAGCCGGGCGATGACCAGAGCAGCAGCTCGATGGCGACGGCTCAGCTCAAGTCGCACGTATC
GCTGCTACGCACCAGGGAGACGCAGCTGCAAATGATTATCGCGCTTGAGATCTTGGCGCTCGAGCCGCTCAAGGC
CGGCGAAGACGTTCTGCCGCGGCTGCCTGAGGCCGAGTCGAACGGGGAGCCGACGACGCCGGTGCCGGCGCCTAG
GAAGCGCAGCAGGCTCAATCTCCAGCTGCTGATTGACGTTCATGCCGATCGCCTTACTATCTGGCAGTCGATTGC
TTCGGATGAGCAGCTTTTGCTGGGGGAGTCGCAGGTTTCGCGACAGCCTGATGGGCAGCTTCAGCCGAGGACGTC
GGCGGAGCCCCTGAGGGACTTTTGCGTTGACATTATTGTACCTTTGTCAGTGTTTTTTTTTCTTGGTTTAAACTG
TTATCGATGAGGTTTGAAGCTAACATTGCAAGCAGCTTCTCTTCCCGTCTGCCGGAAATCTGCGACGGGATCAAC
CGCAAGCTCGGCGGACCGCTACTTCTCTCACCCCCAAAGCCCAAGCCATCGCGGACGGCGCCCAAGAAGCGAGAG
CAGAAGCCCGGAACGGCAGCCAAGCGGCCGACGCCCGTCAGGTCGCAGAGGACGCTGCAGCGGGCGCTATCAGCC
GAGCAGCAGCACCGCAGGAGTCTCTCTCGCGGGCCCAGCAACGCCATCGCCCTCTTGCGATCCGCTACCACGGCT
TCGCTCGTCAATGTCAAGAGGGAGGGTAGCGAGCCGACGTCCGCGAGGAACTTGAAGGAAGCGCCGAGGCTGGCG
CCGGCGTGGAAGAGGCCGCCTTTGTCGCACAGCGCGAGTGCTCCTCACTTGGTCGCTGGCTCTAAGGAGAGTCGG
AAGGCCTTGGTTGAGGCTGAGCTCAAGGACGCCATCTCGGCGTTGAGGAAGCCTAATCGTGATGTTGTTGGCAAG
GCTATGGCTGAGGCTGATGAGCGTCGTCTTCTGTCGGCCAAGAGTGGGTTTTTCTTCTACTCTTCTACTCTTCTA
CTCTTCTCCTGAGCTTGAAGAGCCAGTCACTGACACGAAGCAGAAGCCAAGAAACCGCCGTCTCGAGCCCCCGTC
GTCGTCAAGGCAACGCCAGCAACAACTCGCTTCACCGACGTCCTCGCCCCAAACCGTCACAGCACAGGCGATCAC
GCTCCCCCCTTCGGCGTACAACATTCGCCAGTCCTCCCCTCAAGCGACGGCAAACGCATCATCCCATCGACGGGA
CAACGCCCAAGTCACAGAGACGCCTTTTCCATCGTCGGCGCCTCGTCCCCGCCCGCGGCCGACTTTGTCGTCGAC
GACACGCCCATGAAGCCGCCTGCCAGACCGTGTTTCATCCGTCGGTTTGTCGGTGAGGCTCTTGCTGTGCCGGCG
CCGCCTTCTTCGCCTCTTGCTGGTGCGGGGAGGGGGGAGTTGTCGGTTTTGGACACGCCTGTTAGGGATTCGGGA
GGGGGTGTGTTGGGGGTCGATTTATCGTCGGCTTGGGTGGGAGGACGATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail