Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|07120
Gene name
Locationscaffold_09:661403..661886
Strand-
Gene length (bp)483
Transcript length (bp)429
Coding sequence length (bp)429
Protein length (aa) 143

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10190 Tmemb_170 Putative transmembrane protein 170 5.0E-26 35 137

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.5

Transmembrane Domains

Domain # Start End Length
1 44 66 22
2 79 101 22
3 116 138 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 48.65 18.98 78.31
Alive In ants, during behavior modification 28.14 8.60 47.67
Dead In ants, recently dead 31.95 10.29 53.61

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.048841 yes
Alive Dead 0.670571 no
Dead Fungus 0.137395 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|07120
MSYPNDPPPGYETPDWPGLGLPILGDHTPDKRHTLYTVGASWRFTLLWTLVTYAVVHVAVVFIAFCTHGWKRASW
KYTWALPIIYLIVAGIEAVFAGSVTGLMVGAIYRAGYHEMNTWVPLVWGFINVLVLIVSSFSFSGGL*
Coding >Ophcf2|07120
ATGTCGTACCCGAATGATCCGCCGCCGGGCTACGAGACGCCAGACTGGCCAGGCCTGGGCCTCCCCATCCTTGGC
GACCATACGCCAGATAAGCGGCACACGCTCTACACCGTCGGCGCCTCATGGCGCTTCACGCTGCTGTGGACGCTC
GTCACCTACGCCGTCGTCCATGTCGCCGTCGTCTTCATCGCCTTCTGCACGCACGGATGGAAGCGGGCGTCGTGG
AAATACACCTGGGCGCTACCCATAATATACCTCATCGTCGCCGGCATCGAAGCCGTCTTTGCCGGCAGCGTCACA
GGTCTGATGGTGGGGGCTATCTATAGGGCGGGCTATCATGAGATGAACACTTGGGTTCCCCTCGTCTGGGGTTTC
ATCAATGTTCTCGTCCTCATCGTCTCTTCCTTTTCCTTTTCAGGAGGGTTATGA
Transcript >Ophcf2|07120
ATGTCGTACCCGAATGATCCGCCGCCGGGCTACGAGACGCCAGACTGGCCAGGCCTGGGCCTCCCCATCCTTGGC
GACCATACGCCAGATAAGCGGCACACGCTCTACACCGTCGGCGCCTCATGGCGCTTCACGCTGCTGTGGACGCTC
GTCACCTACGCCGTCGTCCATGTCGCCGTCGTCTTCATCGCCTTCTGCACGCACGGATGGAAGCGGGCGTCGTGG
AAATACACCTGGGCGCTACCCATAATATACCTCATCGTCGCCGGCATCGAAGCCGTCTTTGCCGGCAGCGTCACA
GGTCTGATGGTGGGGGCTATCTATAGGGCGGGCTATCATGAGATGAACACTTGGGTTCCCCTCGTCTGGGGTTTC
ATCAATGTTCTCGTCCTCATCGTCTCTTCCTTTTCCTTTTCAGGAGGGTTATGA
Gene >Ophcf2|07120
ATGTCGTACCCGAATGATCCGCCGCCGGGCTACGAGACGCCAGACTGGCCAGGCCTGGGCCTCCCCATCCTTGGC
GACCATACGCCAGATAAGCGGCACACGCTCTACACCGTCGGCGCCTCATGGCGCTTCACGCTGCTGTGGACGCTC
GTCACCTACGCCGTCGTCCATGTCGCCGTCGTCTTCATCGCCTTCTGCACGCACGGATGGAAGCGGGCGTCGTGG
AAATACACCTGGGCGCTACCCATAATATACCTCATCGTCGCCGGCATCGAAGCCGTCTTTGCCGGCAGCGTCACA
GGTCTGATGTAGGTGCATGATTTGGCATCCTAGGTCTGGCCTGGCTGACGATGGCGGCGCAGGGTGGGGGCTATC
TATAGGGCGGGCTATCATGAGATGAACACTTGGGTTCCCCTCGTCTGGGGTTTCATCAATGTTCTCGTCCTCATC
GTCTCTTCCTTTTCCTTTTCAGGAGGGTTATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail