Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|07118
Gene name
Locationscaffold_09:658207..659899
Strand+
Gene length (bp)1692
Transcript length (bp)1467
Coding sequence length (bp)1467
Protein length (aa) 489

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03062 MBOAT MBOAT, membrane-bound O-acyltransferase family 5.6E-21 261 459

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 62 0.45

Transmembrane Domains

Domain # Start End Length
1 75 94 19
2 117 139 22
3 174 196 22
4 288 310 22
5 334 356 22
6 403 425 22
7 429 451 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|07118
MSASTATGVESTTDTTTRRHLGDDATASQSSNGTTTTLETTSPAPRHHIYRHVAAVHRRTRPSCLSHDSNAAPSF
IGFRNLMVIVLVVGNLRLLVENMQKYGVLICFRCHAYSRQDIIIGGLLYFLIPCHLVAAYLLELAAAGQALETRK
RMKPGASGPSEKDKEDFHSTWIVIAWIHGINVTLALVITSAVVYFFVHHPLIGTLTEMHAVIVWLKTASYALTNR
DLRHAYLHPADDHLIPPLYAERPYPRNITIGNLIYFWWAPTLVYQPVYPRTDKIRWLFLIKRLGECFCLSAFIWF
ASFQYAAPVLRNSLDKIASLDIASIFERLLKLSTISLVIWLAGFFALFQSFLNALAEMLRFGDRAFYDDWWNSES
LGAYWRTWNKPVYTYFKRHVYIPLKARGWSSTMASSVVFLASAVLHEILVGVPTHNIIGVAFLGMLLQLPLIHLT
APLENMKLGKSGKLVGNIIFWAKYGSVSREMEHKEVNV*
Coding >Ophcf2|07118
ATGAGTGCGTCTACGGCGACTGGCGTCGAATCGACGACCGACACAACCACTCGACGTCATCTCGGCGACGACGCG
ACAGCGTCCCAGTCCTCCAATGGCACCACCACCACCCTTGAGACAACCTCACCCGCGCCTCGACACCACATCTAT
CGTCATGTCGCTGCTGTTCACCGGCGAACAAGGCCATCGTGTCTCAGCCACGACTCGAATGCCGCCCCCAGCTTC
ATCGGATTCCGCAATCTCATGGTTATTGTTCTGGTCGTCGGTAACCTGCGATTACTAGTCGAGAATATGCAAAAG
TACGGCGTCTTGATCTGCTTTAGGTGCCACGCATACAGCCGCCAGGACATCATCATCGGAGGCTTGCTCTACTTC
CTTATTCCCTGTCACCTCGTGGCCGCGTATCTTCTCGAGCTCGCCGCCGCTGGCCAGGCGCTGGAGACGCGGAAA
CGTATGAAACCTGGCGCCAGCGGCCCATCGGAGAAGGATAAAGAGGATTTTCACTCGACCTGGATCGTCATCGCG
TGGATCCACGGCATCAACGTGACACTAGCTCTAGTGATAACATCAGCCGTCGTCTACTTCTTCGTCCATCACCCG
CTCATCGGTACCCTCACCGAGATGCACGCAGTCATCGTATGGCTCAAGACGGCATCCTACGCCCTGACGAACCGC
GACCTCCGCCACGCATACCTGCATCCCGCCGACGATCATCTCATCCCGCCGCTGTACGCTGAACGCCCGTATCCG
CGAAACATCACGATCGGCAACCTCATCTACTTCTGGTGGGCTCCGACCCTCGTCTACCAGCCAGTCTATCCTCGG
ACCGACAAAATCAGATGGCTGTTCCTCATCAAAAGGCTCGGCGAGTGCTTTTGTCTCAGCGCCTTCATCTGGTTC
GCTAGCTTCCAGTATGCAGCCCCGGTCCTACGCAACTCGTTGGATAAGATTGCTTCGCTCGACATTGCCTCCATC
TTCGAACGGCTGCTGAAGCTGTCGACCATCTCACTCGTCATCTGGCTCGCCGGTTTCTTTGCCCTCTTCCAGTCT
TTCCTCAATGCCCTTGCCGAGATGCTGCGCTTCGGCGACCGGGCTTTCTACGACGACTGGTGGAACAGCGAGAGC
TTGGGCGCCTACTGGAGGACGTGGAACAAGCCCGTCTACACCTACTTCAAGCGACACGTTTACATCCCCCTGAAA
GCTCGTGGCTGGAGCTCGACCATGGCCAGCTCCGTCGTTTTCTTGGCGTCCGCCGTCCTGCACGAGATTCTCGTC
GGCGTGCCTACGCACAACATTATCGGGGTCGCCTTCCTCGGTATGCTCCTCCAGCTTCCTCTGATTCACTTGACG
GCGCCACTGGAGAACATGAAGCTCGGTAAGAGCGGGAAGCTTGTTGGCAACATCATATTCTGGGCCAAGTACGGC
AGCGTAAGCCGAGAGATGGAGCACAAAGAGGTCAATGTGTAA
Transcript >Ophcf2|07118
ATGAGTGCGTCTACGGCGACTGGCGTCGAATCGACGACCGACACAACCACTCGACGTCATCTCGGCGACGACGCG
ACAGCGTCCCAGTCCTCCAATGGCACCACCACCACCCTTGAGACAACCTCACCCGCGCCTCGACACCACATCTAT
CGTCATGTCGCTGCTGTTCACCGGCGAACAAGGCCATCGTGTCTCAGCCACGACTCGAATGCCGCCCCCAGCTTC
ATCGGATTCCGCAATCTCATGGTTATTGTTCTGGTCGTCGGTAACCTGCGATTACTAGTCGAGAATATGCAAAAG
TACGGCGTCTTGATCTGCTTTAGGTGCCACGCATACAGCCGCCAGGACATCATCATCGGAGGCTTGCTCTACTTC
CTTATTCCCTGTCACCTCGTGGCCGCGTATCTTCTCGAGCTCGCCGCCGCTGGCCAGGCGCTGGAGACGCGGAAA
CGTATGAAACCTGGCGCCAGCGGCCCATCGGAGAAGGATAAAGAGGATTTTCACTCGACCTGGATCGTCATCGCG
TGGATCCACGGCATCAACGTGACACTAGCTCTAGTGATAACATCAGCCGTCGTCTACTTCTTCGTCCATCACCCG
CTCATCGGTACCCTCACCGAGATGCACGCAGTCATCGTATGGCTCAAGACGGCATCCTACGCCCTGACGAACCGC
GACCTCCGCCACGCATACCTGCATCCCGCCGACGATCATCTCATCCCGCCGCTGTACGCTGAACGCCCGTATCCG
CGAAACATCACGATCGGCAACCTCATCTACTTCTGGTGGGCTCCGACCCTCGTCTACCAGCCAGTCTATCCTCGG
ACCGACAAAATCAGATGGCTGTTCCTCATCAAAAGGCTCGGCGAGTGCTTTTGTCTCAGCGCCTTCATCTGGTTC
GCTAGCTTCCAGTATGCAGCCCCGGTCCTACGCAACTCGTTGGATAAGATTGCTTCGCTCGACATTGCCTCCATC
TTCGAACGGCTGCTGAAGCTGTCGACCATCTCACTCGTCATCTGGCTCGCCGGTTTCTTTGCCCTCTTCCAGTCT
TTCCTCAATGCCCTTGCCGAGATGCTGCGCTTCGGCGACCGGGCTTTCTACGACGACTGGTGGAACAGCGAGAGC
TTGGGCGCCTACTGGAGGACGTGGAACAAGCCCGTCTACACCTACTTCAAGCGACACGTTTACATCCCCCTGAAA
GCTCGTGGCTGGAGCTCGACCATGGCCAGCTCCGTCGTTTTCTTGGCGTCCGCCGTCCTGCACGAGATTCTCGTC
GGCGTGCCTACGCACAACATTATCGGGGTCGCCTTCCTCGGTATGCTCCTCCAGCTTCCTCTGATTCACTTGACG
GCGCCACTGGAGAACATGAAGCTCGGTAAGAGCGGGAAGCTTGTTGGCAACATCATATTCTGGGCCAAGTACGGC
AGCGTAAGCCGAGAGATGGAGCACAAAGAGGTCAATGTGTAA
Gene >Ophcf2|07118
ATGAGTGCGTCTACGGCGACTGGCGTCGAATCGACGACCGACACAACCACTCGACGTCATCTCGGCGACGACGCG
ACAGCGTCCCAGTCCTCCAATGGCACCACCACCACCCTTGAGACAACCTCACCCGCGCCTCGACACCACATCTAT
CGTCATGTCGCTGCTGTTCACCGGCGAACAAGGCCATCGTGTCTCAGCCACGACTCGAATGCCGCCCCCAGCTTC
ATCGGATTCCGCAATCTCATGGTTATTGTTCTGGGTAAGCGGTGTCACGGCCGACGCTACCCAGGTCCCTCGTCG
CTAATGAACGTCAGTCGTCGGTAACCTGCGATTACTAGTCGAGAATATGCAAAAGGCTTGTTCTCGCCTTGCGCC
TGTTTTTCCTCTGCGGAGGCTGACATCAGTCACAGTACGGCGTCTTGATCTGCTTTAGGTGCCACGCATACAGCC
GCCAGGACATCATCATCGGAGGCTTGCTCTACTTCCTTATTCCCTGTCACCTCGTGGCCGCGTATCTTCTCGAGC
TCGCCGCCGCTGGCCAGGCGCTGGAGACGCGGAAACGTATGAAACCTGGCGCCAGCGGCCCATCGGAGAAGGATA
AAGAGGATTTTCACTCGACCTGGATCGTCATCGCGTGGATCCACGGCATCAACGTGACACTAGCTCTAGTGATAA
CATCAGCCGTCGTCTACTTCTTCGTCCATCACCCGCTCATCGGTACCCTCACCGAGATGCACGCAGTCATCGTAT
GGCTCAAGACGGCATCCTACGCCCTGACGAACCGCGACCTCCGCCACGCATACCTGCATCCCGCCGACGATCATC
TCATCCCGCCGCTGTACGCTGAACGCCCGTATCCGCGAAACATCACGATCGGCAACCTCATCTACTTCTGGTGGG
CTCCGACCCTCGTCTACCAGCCAGTCTATCCTCGGACCGACAAAATCAGATGGCTGTTCCTCATCAAAAGGCTCG
GCGAGTGCTTTTGTCTCAGCGCCTTCATCTGGTTCGCTAGCTTCCAGTATGCAGCCCCGGTCCTACGCAACTCGT
TGGATAAGATTGCTTCGCTCGACATTGCCTCCATCTTCGAACGGCTGCTGAAGCTGTCGACCATCTCACTCGTCA
TCTGGCTCGCCGGTTTCTTTGCCCTCTTCCAGTCTTTCCTCAATGCCCTTGCCGAGATGCTGCGCTTCGGCGACC
GGGCTTTCTACGACGACTGGTGGAACAGCGAGAGCTTGGGCGCCTACTGGAGGACGTGGAACAAGCCCGTCTACA
CCTACTTCAAGCGACACGTTTACATCCCCCTGAAAGCTCGTGGCTGGAGCTCGACCATGGCCAGCTCCGTCGTTT
TCTTGGCGTCCGCCGTCCTGCACGAGATTCTCGTCGGCGTGCCTACGCACAACATTATCGGTGAGTCTGGCATCG
TCGCGTTGCATACCGGAAGCTGATTCTGTACAATCATAAGGGGTCGCCTTCCTCGGTATGCTCCTCCAGCTTCCT
CTGATTCACTTGACGGCGCCACTGGAGAACATGAAGCTCGGTAAGAGCGGGAAGCTTGTTGGCAACATCATATTC
TGGGTATCTTTTACCATATTCGGGCAGCCTTTTGCGGCGTTGATGTATTTCTACGCTTGGCAGGCCAAGTACGGC
AGCGTAAGCCGAGAGATGGAGCACAAAGAGGTCAATGTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail