Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|07115
Gene name
Locationscaffold_09:653880..654933
Strand+
Gene length (bp)1053
Transcript length (bp)1053
Coding sequence length (bp)1053
Protein length (aa) 351

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01223 Endonuclease_NS DNA/RNA non-specific endonuclease 3.3E-69 82 312

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003676 nucleic acid binding Yes
GO:0046872 metal ion binding Yes
GO:0043169 cation binding No
GO:1901363 heterocyclic compound binding No
GO:0003824 catalytic activity No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.5

Transmembrane Domains

Domain # Start End Length
1 5 27 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|07115
MSKSTLAMFAALGAGGGAALTAAVYSLRSSYTTSSSSARTDSSSSPTSRPSPSEIFNPSPSTSLAAAAAAAAATL
SDRPVNPAGLFEYGFPGPISDLAFRTALVSSYDRRTRNPHWVVEHITPASLAKREGDRRSSTFAEDDDIPTKFRA
LLRDYFRSGYDRGHQVPAADAKWSQAAMDDTFYLSNMCPQVGEGFNRDYWAHFEDFCRRLTVQYPSVRIVTGPLY
LPRKDPVDNKWYVRYEMIGSPPSVAVPTHFYKVIFAEDGRAEGQVAIGAFVLPNAPISNEKPITDFEVPVEAVER
ASGLEFATKLPAQRRRRLCADTACALVIRDYVDRQKAFAKGDKRGGSASK*
Coding >Ophcf2|07115
ATGTCGAAATCTACCCTCGCCATGTTTGCTGCTTTGGGTGCTGGAGGCGGCGCTGCCTTGACAGCCGCCGTTTAC
TCTCTTCGCTCGAGCTATACCACATCGTCCTCCTCCGCAAGAACCGATTCATCATCATCGCCCACCTCCCGCCCT
TCTCCCTCAGAAATCTTCAACCCATCACCTTCCACCTCCCTCGCCGCCGCCGCCGCCGCCGCCGCCGCCACCCTC
TCCGACCGCCCCGTCAACCCAGCCGGCCTCTTCGAATACGGCTTCCCAGGCCCCATCTCAGACCTCGCCTTCCGC
ACAGCCCTAGTCTCAAGCTACGACCGCCGAACCCGTAACCCCCACTGGGTGGTGGAGCACATAACGCCCGCCTCG
CTGGCCAAACGCGAGGGCGATCGCCGCTCCAGCACCTTTGCGGAAGACGACGACATACCCACCAAGTTCCGAGCC
TTGCTCCGCGATTACTTCCGCAGCGGCTACGACCGCGGCCATCAAGTTCCTGCCGCCGACGCGAAATGGTCGCAG
GCAGCCATGGACGATACTTTTTACCTGAGCAACATGTGTCCCCAGGTTGGAGAGGGCTTCAACCGTGATTACTGG
GCGCATTTCGAGGATTTCTGCCGGAGACTTACTGTTCAGTACCCTTCTGTGAGGATTGTTACGGGACCGCTTTAC
CTTCCGCGAAAAGACCCCGTCGATAACAAGTGGTACGTCCGCTACGAAATGATCGGCAGTCCACCATCCGTCGCG
GTCCCGACCCATTTCTACAAGGTCATCTTCGCCGAGGATGGTCGCGCGGAGGGTCAAGTCGCCATAGGAGCCTTT
GTCCTTCCCAACGCTCCCATCTCCAATGAGAAGCCCATCACCGACTTCGAGGTGCCTGTCGAGGCCGTTGAGCGC
GCGAGTGGCCTGGAGTTCGCGACCAAGTTGCCGGCTCAGAGGCGGAGGAGGCTCTGCGCTGATACCGCTTGCGCT
CTCGTCATTCGCGACTATGTTGATAGGCAAAAGGCCTTTGCTAAGGGGGATAAGCGCGGGGGTTCGGCGTCGAAG
TGA
Transcript >Ophcf2|07115
ATGTCGAAATCTACCCTCGCCATGTTTGCTGCTTTGGGTGCTGGAGGCGGCGCTGCCTTGACAGCCGCCGTTTAC
TCTCTTCGCTCGAGCTATACCACATCGTCCTCCTCCGCAAGAACCGATTCATCATCATCGCCCACCTCCCGCCCT
TCTCCCTCAGAAATCTTCAACCCATCACCTTCCACCTCCCTCGCCGCCGCCGCCGCCGCCGCCGCCGCCACCCTC
TCCGACCGCCCCGTCAACCCAGCCGGCCTCTTCGAATACGGCTTCCCAGGCCCCATCTCAGACCTCGCCTTCCGC
ACAGCCCTAGTCTCAAGCTACGACCGCCGAACCCGTAACCCCCACTGGGTGGTGGAGCACATAACGCCCGCCTCG
CTGGCCAAACGCGAGGGCGATCGCCGCTCCAGCACCTTTGCGGAAGACGACGACATACCCACCAAGTTCCGAGCC
TTGCTCCGCGATTACTTCCGCAGCGGCTACGACCGCGGCCATCAAGTTCCTGCCGCCGACGCGAAATGGTCGCAG
GCAGCCATGGACGATACTTTTTACCTGAGCAACATGTGTCCCCAGGTTGGAGAGGGCTTCAACCGTGATTACTGG
GCGCATTTCGAGGATTTCTGCCGGAGACTTACTGTTCAGTACCCTTCTGTGAGGATTGTTACGGGACCGCTTTAC
CTTCCGCGAAAAGACCCCGTCGATAACAAGTGGTACGTCCGCTACGAAATGATCGGCAGTCCACCATCCGTCGCG
GTCCCGACCCATTTCTACAAGGTCATCTTCGCCGAGGATGGTCGCGCGGAGGGTCAAGTCGCCATAGGAGCCTTT
GTCCTTCCCAACGCTCCCATCTCCAATGAGAAGCCCATCACCGACTTCGAGGTGCCTGTCGAGGCCGTTGAGCGC
GCGAGTGGCCTGGAGTTCGCGACCAAGTTGCCGGCTCAGAGGCGGAGGAGGCTCTGCGCTGATACCGCTTGCGCT
CTCGTCATTCGCGACTATGTTGATAGGCAAAAGGCCTTTGCTAAGGGGGATAAGCGCGGGGGTTCGGCGTCGAAG
TGA
Gene >Ophcf2|07115
ATGTCGAAATCTACCCTCGCCATGTTTGCTGCTTTGGGTGCTGGAGGCGGCGCTGCCTTGACAGCCGCCGTTTAC
TCTCTTCGCTCGAGCTATACCACATCGTCCTCCTCCGCAAGAACCGATTCATCATCATCGCCCACCTCCCGCCCT
TCTCCCTCAGAAATCTTCAACCCATCACCTTCCACCTCCCTCGCCGCCGCCGCCGCCGCCGCCGCCGCCACCCTC
TCCGACCGCCCCGTCAACCCAGCCGGCCTCTTCGAATACGGCTTCCCAGGCCCCATCTCAGACCTCGCCTTCCGC
ACAGCCCTAGTCTCAAGCTACGACCGCCGAACCCGTAACCCCCACTGGGTGGTGGAGCACATAACGCCCGCCTCG
CTGGCCAAACGCGAGGGCGATCGCCGCTCCAGCACCTTTGCGGAAGACGACGACATACCCACCAAGTTCCGAGCC
TTGCTCCGCGATTACTTCCGCAGCGGCTACGACCGCGGCCATCAAGTTCCTGCCGCCGACGCGAAATGGTCGCAG
GCAGCCATGGACGATACTTTTTACCTGAGCAACATGTGTCCCCAGGTTGGAGAGGGCTTCAACCGTGATTACTGG
GCGCATTTCGAGGATTTCTGCCGGAGACTTACTGTTCAGTACCCTTCTGTGAGGATTGTTACGGGACCGCTTTAC
CTTCCGCGAAAAGACCCCGTCGATAACAAGTGGTACGTCCGCTACGAAATGATCGGCAGTCCACCATCCGTCGCG
GTCCCGACCCATTTCTACAAGGTCATCTTCGCCGAGGATGGTCGCGCGGAGGGTCAAGTCGCCATAGGAGCCTTT
GTCCTTCCCAACGCTCCCATCTCCAATGAGAAGCCCATCACCGACTTCGAGGTGCCTGTCGAGGCCGTTGAGCGC
GCGAGTGGCCTGGAGTTCGCGACCAAGTTGCCGGCTCAGAGGCGGAGGAGGCTCTGCGCTGATACCGCTTGCGCT
CTCGTCATTCGCGACTATGTTGATAGGCAAAAGGCCTTTGCTAAGGGGGATAAGCGCGGGGGTTCGGCGTCGAAG
TGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail