Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|07110
Gene name
Locationscaffold_09:641009..643720
Strand+
Gene length (bp)2711
Transcript length (bp)2592
Coding sequence length (bp)2592
Protein length (aa) 864

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07792 Afi1 Docking domain of Afi1 for Arf3 in vesicle trafficking 1.5E-39 100 273
PF08616 SPA Stabilization of polarity axis 2.5E-37 461 570

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6677 0.2216 0.2223 0.1691 0.0849 0.0054 0.1608 0.3481 0.315 0.1147

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3071
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5219
Ophiocordyceps australis map64 (Brazil) OphauB2|6899
Ophiocordyceps camponoti-floridani Ophcf2|07110 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6458
Ophiocordyceps kimflemingae Ophio5|6759
Ophiocordyceps subramaniannii Hirsu2|533

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|07110
MALPYLSRYNGRPRRTSLSSILSSRSPSEMSHASRTPQAAVATDTDRTSDPSTKSKTPSFGLSSQHSSLSAPRRL
NADARSTRRLRSQYPRGSPENHVEYILVASFDIDRGPVMEHQYPFAITGDENMLAELMLPDQAHARNQDWTIFFL
HKDITQEEEDEKRRQRERRRRRRRRCRRHHRHLVNNEANNGTDARADNDVDGDGDEHDDNDDDENFDDEDTQGRD
AYDDGDGDDGDDDGDDDDEDSTDSELDGEGPPLVHVLNLVNTKHDKSVKRGAVVKAMAVCTRHPFLHIYKPLLLL
ALEEYFKSPALETLALLYDAVNAMDLSLMPKLSILERSLLLASDNKDLFVEKFELMIQMRLAEDRGEAADDGLDG
SSPNRLAGISRAGTKAHIEGGGHQAMYSVPRDTHEFETKVMYKGIPIPVKVPTAVMPETVGDFSLVKLIQNFSEP
QAKSPQPFPLHPHLTTNGPGTHPIIVLVNALLTQKRVIFLGHNLPSGEVAEAVLAACALVSGGLLRGFTRHAFPY
TDLTKIDDLLNVPGFIAGVTNPTFEHHPEWWDILCDLPSGRVKISSKIEQPPPSEGLVYFQHQNPTLAAVAAGTG
GGGGGGVGSGSGSSSSQQDLTGDAAFMADVTRSIAARHGERVIRAKWRGWVLKFTRVAAQFEETVYGASALCMSS
DDVDPALLPGASGHGYVWADDAARTKELAGNVTRIEGWRNTRSYYSFIHDLTRMHTLRPLKGLDLAHMHDRLRLQ
RLTPVQSRDIYLTFARYVHSYDEICLLLNVAPESHAGLFYLALGLFHKDRDVRVKTAELLDHISVHEAGQHWWKG
LSRFERLAFDRLRRETEAEMRVKLIKEGLSPVLDRRTS*
Coding >Ophcf2|07110
ATGGCTCTTCCCTATCTCTCCCGTTACAACGGCCGTCCCCGCCGAACCTCTCTCTCGTCCATCCTCTCGTCGCGC
TCGCCGTCGGAGATGTCACATGCGTCGAGGACGCCGCAGGCGGCCGTGGCCACCGACACGGACCGCACCTCGGAT
CCCAGCACAAAGTCCAAGACGCCTTCTTTCGGTCTGTCGTCTCAGCACTCGTCCCTGTCGGCTCCGAGACGTCTC
AACGCCGACGCCCGCTCTACCCGGAGGCTGCGGTCTCAGTATCCTCGCGGTTCTCCCGAGAATCATGTCGAGTAC
ATCCTCGTTGCCTCCTTCGACATCGACCGTGGGCCCGTAATGGAGCACCAGTATCCTTTTGCCATCACCGGTGAC
GAGAACATGCTGGCTGAGCTGATGCTGCCGGATCAGGCTCACGCCCGCAACCAGGATTGGACCATTTTTTTCCTG
CATAAGGACATTACTCAGGAGGAAGAGGACGAGAAGCGTCGTCAAAGAGAACGCCGCCGTCGCCGCAGACGCAGG
TGCCGGAGGCATCACCGCCATCTGGTCAACAACGAGGCCAACAACGGCACCGATGCTCGTGCCGACAACGACGTT
GACGGTGACGGAGACGAACATGACGACAACGACGACGACGAAAACTTTGACGACGAAGACACCCAAGGCCGTGAC
GCTTACGACGATGGCGACGGCGACGACGGCGACGACGACGGCGACGACGACGACGAAGATTCGACAGACAGCGAG
CTCGACGGCGAAGGCCCGCCATTGGTACACGTGCTGAACCTGGTCAACACCAAGCATGACAAGTCGGTGAAGCGA
GGCGCCGTCGTCAAGGCCATGGCCGTCTGTACGCGACATCCCTTCCTGCACATATACAAGCCGCTGCTTCTGCTC
GCGCTAGAAGAATACTTCAAGTCGCCGGCGCTCGAGACGCTGGCACTGCTGTACGACGCCGTCAACGCCATGGAC
CTGTCGTTAATGCCCAAACTCAGCATCCTCGAGAGGAGCCTGCTGCTGGCGAGCGACAACAAGGACCTCTTTGTC
GAAAAGTTTGAGCTCATGATACAAATGCGTCTGGCCGAAGACCGCGGCGAGGCAGCTGACGACGGCCTCGATGGC
AGCAGCCCGAACCGCCTGGCCGGCATCTCCCGGGCCGGGACCAAGGCGCACATCGAGGGAGGCGGCCACCAGGCC
ATGTATTCGGTGCCGCGCGACACGCACGAGTTCGAGACCAAGGTCATGTACAAGGGCATCCCCATCCCCGTCAAG
GTGCCCACGGCCGTGATGCCCGAGACGGTCGGCGACTTTTCCCTCGTCAAACTCATCCAGAACTTCTCGGAGCCT
CAGGCCAAGTCGCCACAGCCCTTCCCGCTTCACCCTCACCTGACGACCAACGGGCCCGGCACGCACCCCATCATA
GTGCTCGTCAACGCCCTGCTCACTCAGAAGCGCGTCATCTTTCTAGGTCACAACTTGCCGTCGGGAGAGGTGGCC
GAAGCAGTGCTGGCCGCCTGCGCCCTCGTTTCGGGCGGTCTTCTCCGGGGCTTCACACGTCACGCCTTTCCCTAC
ACGGACCTGACCAAGATCGACGACCTCCTCAACGTCCCGGGCTTCATCGCCGGAGTGACGAACCCGACGTTTGAG
CACCATCCGGAGTGGTGGGACATCTTGTGCGACCTGCCCAGCGGCCGCGTCAAGATCAGCTCCAAGATCGAGCAG
CCGCCGCCTTCCGAGGGCCTCGTCTACTTCCAGCACCAGAATCCGACGCTGGCGGCCGTGGCGGCGGGCACCGGC
GGTGGAGGCGGAGGCGGAGTCGGCAGCGGCAGCGGCAGCAGCAGCTCTCAGCAGGACCTCACCGGAGACGCCGCC
TTCATGGCCGATGTGACGCGCAGCATCGCGGCGAGACACGGCGAGCGCGTCATCCGGGCAAAGTGGCGAGGCTGG
GTCCTTAAGTTCACTCGCGTCGCCGCTCAGTTCGAGGAGACCGTCTACGGAGCCAGCGCCCTCTGTATGAGCAGT
GATGATGTCGATCCGGCGCTCCTCCCCGGCGCCAGTGGCCATGGATACGTTTGGGCCGACGACGCGGCCAGGACC
AAGGAGTTGGCCGGCAACGTGACGCGCATCGAAGGTTGGCGCAATACGCGCAGTTACTATAGCTTCATCCATGAC
CTCACCCGAATGCATACCCTCCGTCCGCTCAAGGGCCTCGACCTCGCCCACATGCACGACCGTCTCCGGCTCCAG
CGGCTGACACCGGTGCAGAGCCGAGACATCTACCTGACGTTCGCGCGGTACGTGCACTCGTACGACGAGATCTGC
CTTCTCCTCAACGTGGCGCCCGAGTCGCACGCTGGGCTCTTCTACCTGGCTCTCGGTCTCTTCCACAAGGACCGC
GATGTGCGGGTCAAGACGGCCGAGTTGCTGGACCACATCTCGGTACACGAGGCGGGCCAGCACTGGTGGAAGGGT
CTCAGCCGCTTCGAGAGGCTCGCCTTTGACCGGCTGCGGCGCGAGACCGAGGCCGAGATGCGGGTCAAGCTGATC
AAGGAGGGCCTAAGTCCGGTTCTGGACAGAAGAACCAGCTGA
Transcript >Ophcf2|07110
ATGGCTCTTCCCTATCTCTCCCGTTACAACGGCCGTCCCCGCCGAACCTCTCTCTCGTCCATCCTCTCGTCGCGC
TCGCCGTCGGAGATGTCACATGCGTCGAGGACGCCGCAGGCGGCCGTGGCCACCGACACGGACCGCACCTCGGAT
CCCAGCACAAAGTCCAAGACGCCTTCTTTCGGTCTGTCGTCTCAGCACTCGTCCCTGTCGGCTCCGAGACGTCTC
AACGCCGACGCCCGCTCTACCCGGAGGCTGCGGTCTCAGTATCCTCGCGGTTCTCCCGAGAATCATGTCGAGTAC
ATCCTCGTTGCCTCCTTCGACATCGACCGTGGGCCCGTAATGGAGCACCAGTATCCTTTTGCCATCACCGGTGAC
GAGAACATGCTGGCTGAGCTGATGCTGCCGGATCAGGCTCACGCCCGCAACCAGGATTGGACCATTTTTTTCCTG
CATAAGGACATTACTCAGGAGGAAGAGGACGAGAAGCGTCGTCAAAGAGAACGCCGCCGTCGCCGCAGACGCAGG
TGCCGGAGGCATCACCGCCATCTGGTCAACAACGAGGCCAACAACGGCACCGATGCTCGTGCCGACAACGACGTT
GACGGTGACGGAGACGAACATGACGACAACGACGACGACGAAAACTTTGACGACGAAGACACCCAAGGCCGTGAC
GCTTACGACGATGGCGACGGCGACGACGGCGACGACGACGGCGACGACGACGACGAAGATTCGACAGACAGCGAG
CTCGACGGCGAAGGCCCGCCATTGGTACACGTGCTGAACCTGGTCAACACCAAGCATGACAAGTCGGTGAAGCGA
GGCGCCGTCGTCAAGGCCATGGCCGTCTGTACGCGACATCCCTTCCTGCACATATACAAGCCGCTGCTTCTGCTC
GCGCTAGAAGAATACTTCAAGTCGCCGGCGCTCGAGACGCTGGCACTGCTGTACGACGCCGTCAACGCCATGGAC
CTGTCGTTAATGCCCAAACTCAGCATCCTCGAGAGGAGCCTGCTGCTGGCGAGCGACAACAAGGACCTCTTTGTC
GAAAAGTTTGAGCTCATGATACAAATGCGTCTGGCCGAAGACCGCGGCGAGGCAGCTGACGACGGCCTCGATGGC
AGCAGCCCGAACCGCCTGGCCGGCATCTCCCGGGCCGGGACCAAGGCGCACATCGAGGGAGGCGGCCACCAGGCC
ATGTATTCGGTGCCGCGCGACACGCACGAGTTCGAGACCAAGGTCATGTACAAGGGCATCCCCATCCCCGTCAAG
GTGCCCACGGCCGTGATGCCCGAGACGGTCGGCGACTTTTCCCTCGTCAAACTCATCCAGAACTTCTCGGAGCCT
CAGGCCAAGTCGCCACAGCCCTTCCCGCTTCACCCTCACCTGACGACCAACGGGCCCGGCACGCACCCCATCATA
GTGCTCGTCAACGCCCTGCTCACTCAGAAGCGCGTCATCTTTCTAGGTCACAACTTGCCGTCGGGAGAGGTGGCC
GAAGCAGTGCTGGCCGCCTGCGCCCTCGTTTCGGGCGGTCTTCTCCGGGGCTTCACACGTCACGCCTTTCCCTAC
ACGGACCTGACCAAGATCGACGACCTCCTCAACGTCCCGGGCTTCATCGCCGGAGTGACGAACCCGACGTTTGAG
CACCATCCGGAGTGGTGGGACATCTTGTGCGACCTGCCCAGCGGCCGCGTCAAGATCAGCTCCAAGATCGAGCAG
CCGCCGCCTTCCGAGGGCCTCGTCTACTTCCAGCACCAGAATCCGACGCTGGCGGCCGTGGCGGCGGGCACCGGC
GGTGGAGGCGGAGGCGGAGTCGGCAGCGGCAGCGGCAGCAGCAGCTCTCAGCAGGACCTCACCGGAGACGCCGCC
TTCATGGCCGATGTGACGCGCAGCATCGCGGCGAGACACGGCGAGCGCGTCATCCGGGCAAAGTGGCGAGGCTGG
GTCCTTAAGTTCACTCGCGTCGCCGCTCAGTTCGAGGAGACCGTCTACGGAGCCAGCGCCCTCTGTATGAGCAGT
GATGATGTCGATCCGGCGCTCCTCCCCGGCGCCAGTGGCCATGGATACGTTTGGGCCGACGACGCGGCCAGGACC
AAGGAGTTGGCCGGCAACGTGACGCGCATCGAAGGTTGGCGCAATACGCGCAGTTACTATAGCTTCATCCATGAC
CTCACCCGAATGCATACCCTCCGTCCGCTCAAGGGCCTCGACCTCGCCCACATGCACGACCGTCTCCGGCTCCAG
CGGCTGACACCGGTGCAGAGCCGAGACATCTACCTGACGTTCGCGCGGTACGTGCACTCGTACGACGAGATCTGC
CTTCTCCTCAACGTGGCGCCCGAGTCGCACGCTGGGCTCTTCTACCTGGCTCTCGGTCTCTTCCACAAGGACCGC
GATGTGCGGGTCAAGACGGCCGAGTTGCTGGACCACATCTCGGTACACGAGGCGGGCCAGCACTGGTGGAAGGGT
CTCAGCCGCTTCGAGAGGCTCGCCTTTGACCGGCTGCGGCGCGAGACCGAGGCCGAGATGCGGGTCAAGCTGATC
AAGGAGGGCCTAAGTCCGGTTCTGGACAGAAGAACCAGCTGA
Gene >Ophcf2|07110
ATGGCTCTTCCCTATCTCTCCCGTTACAACGGCCGTCCCCGCCGAACCTCTCTCTCGTCCATCCTCTCGTCGCGC
TCGCCGTCGGAGATGTCACATGCGTCGAGGACGCCGCAGGCGGCCGTGGCCACCGACACGGACCGCACCTCGGAT
CCCAGCACAAAGTCCAAGACGCCTTCTTTCGGTCTGTCGTCTCAGCACTCGTCCCTGTCGGCTCCGAGACGTCTC
AACGCCGACGCCCGCTCTACCCGGAGGCTGCGGTCTCAGTATCCTCGCGGTTCTCCCGAGAATCATGTCGAGTAC
ATCCTCGTTGCCTCCTTCGACATCGACCGTGGGCCCGTAATGGAGCACCAGTATCCTTTTGCCATCACCGGTGAC
GAGAACATGCTGGCTGAGCTGATGCTGCCGGATCAGGCTCACGCCCGCAACCAGGATTGGACCATTTTTTTCCTG
CATAAGGACATTACTCAGGAGGAAGAGGACGAGAAGCGTCGTCAAAGAGAACGCCGCCGTCGCCGCAGACGCAGG
TGCCGGAGGCATCACCGCCATCTGGTCAACAACGAGGCCAACAACGGCACCGATGCTCGTGCCGACAACGACGTT
GACGGTGACGGAGACGAACATGACGACAACGACGACGACGAAAACTTTGACGACGAAGACACCCAAGGCCGTGAC
GCTTACGACGATGGCGACGGCGACGACGGCGACGACGACGGCGACGACGACGACGAAGATTCGACAGACAGCGAG
CTCGACGGCGAAGGCCCGCCATTGGTACACGTGCTGAACCTGGTCAACACCAAGCATGACAAGTCGGTGAAGCGA
GGCGCCGTCGTCAAGGCCATGGCCGTCTGTACGCGACATCCCTTCCTGCACATATACAAGGTAAGCAAGCTCATC
TTGTTTGCTTCTCGACTCGACCATGACGGCTAACAAGCATCTCAGCCGCTGCTTCTGCTCGCGCTAGAAGAATAC
TTCAAGTCGCCGGCGCTCGAGACGCTGGCACTGCTGTACGACGCCGTCAACGCCATGGACCTGTCGTTAATGCCC
AAACTCAGCATCCTCGAGAGGAGCCTGCTGCTGGCGAGCGACAACAAGGACCTCTTTGTCGAAAAGTTTGAGCTC
ATGATACAAATGCGTCTGGCCGAAGACCGCGGCGAGGCAGCTGACGACGGCCTCGATGGCAGCAGCCCGAACCGC
CTGGCCGGCATCTCCCGGGCCGGGACCAAGGCGCACATCGAGGGAGGCGGCCACCAGGCCATGTATTCGGTGCCG
CGCGACACGCACGAGTTCGAGACCAAGGTCATGTACAAGGGCATCCCCATCCCCGTCAAGGTGCCCACGGCCGTG
ATGCCCGAGACGGTCGGCGACTTTTCCCTCGTCAAACTCATCCAGAACTTCTCGGAGCCTCAGGCCAAGTCGCCA
CAGCCCTTCCCGCTTCACCCTCACCTGACGACCAACGGGCCCGGCACGCACCCCATCATAGTGCTCGTCAACGCC
CTGCTCACTCAGAAGCGCGTCATCTTTCTAGGTCACAACTTGCCGTCGGGAGAGGTGGCCGAAGCAGTGCTGGCC
GCCTGCGCCCTCGTTTCGGGCGGTCTTCTCCGGGGCTTCACACGTCACGCCTTTCCCTACACGGACCTGACCAAG
ATCGACGACCTCCTCAACGTCCCGGGCTTCATCGCCGGAGTGACGAACCCGACGTTTGAGCACCATCCGGAGTGG
TGGGACATCTTGTGCGACCTGCCCAGCGGCCGCGTCAAGATCAGCTCCAAGATCGAGCAGCCGCCGCCTTCCGAG
GGCCTCGTCTACTTCCAGCACCAGAATCCGACGCTGGCGGCCGTGGCGGCGGGCACCGGCGGTGGAGGCGGAGGC
GGAGTCGGCAGCGGCAGCGGCAGCAGCAGCTCTCAGCAGGACCTCACCGGAGACGCCGCCTTCATGGCCGATGTG
ACGCGCAGCATCGCGGCGAGACACGGCGAGCGCGTCATCCGGGCAAAGTGGCGAGGCTGGGTCCTTAAGTTCACT
CGCGTCGCCGCTCAGTTCGAGGAGACCGTCTACGGAGCCAGCGCCCTCTGTATGAGCAGTGATGATGTCGATCCG
GCGCTCCTCCCCGGCGCCAGTGGCCATGGATACGTTTGGGCCGACGACGCGGCCAGGACCAAGGAGTTGGCCGGC
AACGTGACGCGCATCGAAGGTTGGCGCAATACGCGCAGTTACTATAGCTTCATCCATGTGAGAGACGGATCGTCG
AGGAGCGTCTGTTGTGACATGCTCAGCTGACACACATGCAGGACCTCACCCGAATGCATACCCTCCGTCCGCTCA
AGGGCCTCGACCTCGCCCACATGCACGACCGTCTCCGGCTCCAGCGGCTGACACCGGTGCAGAGCCGAGACATCT
ACCTGACGTTCGCGCGGTACGTGCACTCGTACGACGAGATCTGCCTTCTCCTCAACGTGGCGCCCGAGTCGCACG
CTGGGCTCTTCTACCTGGCTCTCGGTCTCTTCCACAAGGACCGCGATGTGCGGGTCAAGACGGCCGAGTTGCTGG
ACCACATCTCGGTACACGAGGCGGGCCAGCACTGGTGGAAGGGTCTCAGCCGCTTCGAGAGGCTCGCCTTTGACC
GGCTGCGGCGCGAGACCGAGGCCGAGATGCGGGTCAAGCTGATCAAGGAGGGCCTAAGTCCGGTTCTGGACAGAA
GAACCAGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail