Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|07099
Gene name
Locationscaffold_09:604530..605892
Strand-
Gene length (bp)1362
Transcript length (bp)1101
Coding sequence length (bp)1101
Protein length (aa) 367

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00180 Iso_dh Isocitrate/isopropylmalate dehydrogenase 3.0E-124 5 346

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Signal peptide 0.5779 0.2558 0.4728 0.0551 0.1767 0.0526 0.3417 0.1728 0.5027 0.3093

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3976
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|344
Ophiocordyceps australis map64 (Brazil) OphauB2|6887
Ophiocordyceps camponoti-floridani Ophcf2|07099 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|496
Ophiocordyceps kimflemingae Ophio5|2721
Ophiocordyceps subramaniannii Hirsu2|7942

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|07099
MAEHKIVVFGGDHCGPEVVAEGIKVLKTLEKHRPSVGRFDFQHHLLGGASIDKHGTALTDSALSAAKSADAVLLG
AIGGPEWGTGAVRPEQGILRLRKELGTYGNLRPCFFASEGLVESSPLKAEVCRGTDIVIVRELTGGIYFGDRKED
DGDGKAWDMEPYARGEVERIARLAGCLARGRGDKVVWSLDKANVLATSRLWRRVMTEVFAAEFPDLKLEHQLIDS
AAMLLVKKPTQLNGVVVTSNLFGDIVSDQVSAIPGSIGLLPSASIGGIPEGDKGCNGIYEPIHGSAPDISGKGIV
NPIGTILSTAMLLRYSLGLPAEARAVEEAVKGALDGGLRTRDLGGRLGRGRWGMRFVGGLLVFWGG*
Coding >Ophcf2|07099
ATGGCGGAGCACAAGATTGTCGTTTTTGGCGGCGACCACTGCGGACCCGAGGTGGTGGCCGAGGGCATCAAGGTG
CTCAAGACGCTCGAGAAGCACCGGCCATCGGTGGGCAGGTTTGACTTTCAGCACCATTTGCTGGGCGGGGCGTCC
ATCGATAAGCACGGCACAGCCCTTACGGACAGCGCCCTCTCGGCTGCCAAGTCGGCCGACGCGGTGCTGTTGGGC
GCCATCGGCGGACCGGAATGGGGGACGGGAGCTGTTCGTCCTGAGCAGGGGATCCTACGACTCCGCAAGGAGCTT
GGAACGTACGGCAACCTGAGGCCTTGTTTCTTTGCGTCCGAGGGGTTGGTGGAATCTTCGCCTCTCAAGGCCGAG
GTCTGTCGCGGGACGGACATTGTCATCGTCCGGGAGCTCACCGGCGGGATCTACTTTGGTGATCGGAAGGAGGAC
GACGGTGATGGCAAGGCTTGGGATATGGAGCCTTATGCGAGGGGGGAGGTTGAGCGCATCGCCAGGCTGGCCGGA
TGTCTCGCGCGCGGAAGGGGGGACAAGGTGGTGTGGTCTCTGGACAAGGCCAACGTTTTGGCGACGAGCAGGCTT
TGGAGGAGGGTCATGACGGAGGTGTTTGCCGCCGAGTTTCCGGATCTGAAGCTTGAGCATCAGCTCATCGACAGT
GCGGCCATGCTGTTGGTCAAGAAGCCCACGCAACTCAACGGCGTGGTCGTCACCAGCAATCTCTTCGGCGATATT
GTCAGCGATCAGGTCAGCGCCATACCCGGAAGTATCGGTCTCCTCCCCAGCGCGAGTATCGGGGGGATTCCGGAG
GGGGACAAGGGGTGCAATGGCATCTACGAGCCCATCCACGGATCCGCACCGGATATCTCGGGCAAGGGCATCGTC
AACCCCATCGGCACCATCCTCTCGACGGCCATGCTCCTCCGTTATAGCCTCGGCCTCCCCGCCGAGGCCCGGGCC
GTGGAGGAGGCCGTCAAGGGGGCGCTGGATGGGGGCCTGCGCACCAGGGATCTGGGGGGGCGATTGGGACGGGGG
AGGTGGGGGATGAGGTTTGTAGGAGGCTTGTTGGTGTTTTGGGGGGGATGA
Transcript >Ophcf2|07099
ATGGCGGAGCACAAGATTGTCGTTTTTGGCGGCGACCACTGCGGACCCGAGGTGGTGGCCGAGGGCATCAAGGTG
CTCAAGACGCTCGAGAAGCACCGGCCATCGGTGGGCAGGTTTGACTTTCAGCACCATTTGCTGGGCGGGGCGTCC
ATCGATAAGCACGGCACAGCCCTTACGGACAGCGCCCTCTCGGCTGCCAAGTCGGCCGACGCGGTGCTGTTGGGC
GCCATCGGCGGACCGGAATGGGGGACGGGAGCTGTTCGTCCTGAGCAGGGGATCCTACGACTCCGCAAGGAGCTT
GGAACGTACGGCAACCTGAGGCCTTGTTTCTTTGCGTCCGAGGGGTTGGTGGAATCTTCGCCTCTCAAGGCCGAG
GTCTGTCGCGGGACGGACATTGTCATCGTCCGGGAGCTCACCGGCGGGATCTACTTTGGTGATCGGAAGGAGGAC
GACGGTGATGGCAAGGCTTGGGATATGGAGCCTTATGCGAGGGGGGAGGTTGAGCGCATCGCCAGGCTGGCCGGA
TGTCTCGCGCGCGGAAGGGGGGACAAGGTGGTGTGGTCTCTGGACAAGGCCAACGTTTTGGCGACGAGCAGGCTT
TGGAGGAGGGTCATGACGGAGGTGTTTGCCGCCGAGTTTCCGGATCTGAAGCTTGAGCATCAGCTCATCGACAGT
GCGGCCATGCTGTTGGTCAAGAAGCCCACGCAACTCAACGGCGTGGTCGTCACCAGCAATCTCTTCGGCGATATT
GTCAGCGATCAGGTCAGCGCCATACCCGGAAGTATCGGTCTCCTCCCCAGCGCGAGTATCGGGGGGATTCCGGAG
GGGGACAAGGGGTGCAATGGCATCTACGAGCCCATCCACGGATCCGCACCGGATATCTCGGGCAAGGGCATCGTC
AACCCCATCGGCACCATCCTCTCGACGGCCATGCTCCTCCGTTATAGCCTCGGCCTCCCCGCCGAGGCCCGGGCC
GTGGAGGAGGCCGTCAAGGGGGCGCTGGATGGGGGCCTGCGCACCAGGGATCTGGGGGGGCGATTGGGACGGGGG
AGGTGGGGGATGAGGTTTGTAGGAGGCTTGTTGGTGTTTTGGGGGGGATGA
Gene >Ophcf2|07099
ATGGCGGAGCACAAGATTGTCGTTTTTGGCGGCGACCACTGCGGACCCGAGGCAGGTTTTTCCCCCGAAGCAGAC
GGAGAGGGAGGGGTTCGACTGACGGCGAGACTTGACAGGTGGTGGCCGAGGGCATCAAGGTAAAAAAGGGGGCCC
CTTGACAACAATGAAGACGAGGCTGAATCGATGGACTTGTCCAGGTGCTCAAGACGCTCGAGAAGCACCGGCCAT
CGGTGGGCAGGTTTGACTTTCAGCACCATTTGCTGGGCGGGGTGAGAGCGAAACGTTTCCCGATCGAGGTGTTCG
ACGGCTAAAGAAGAGGAAATTTGAAAACAATAATAATGATAAAAAACAGGCGTCCATCGATAAGCACGGCACAGC
CCTTACGGACAGCGCCCTCTCGGCTGCCAAGTCGGCCGACGCGGTGCTGTTGGGCGCCATCGGCGGACCGGAATG
GGGGACGGGAGCTGTTCGTCCTGAGCAGGGGATCCTACGACTCCGCAAGGAGCTTGGAACGTACGGCAACCTGAG
GCCTTGTTTCTTTGCGTCCGAGGGGTTGGTGGAATCTTCGCCTCTCAAGGCCGAGGTCTGTCGCGGGACGGACAT
TGTCATCGTCCGGGAGCTCACCGGCGGGATCTACTTTGGTGATCGGAAGGAGGACGACGGTGATGGCAAGGCTTG
GGATATGGAGCCTTATGCGAGGGGGGAGGTTGAGCGCATCGCCAGGCTGGCCGGATGTCTCGCGCGCGGAAGGGG
GGACAAGGTGGTGTGGTCTCTGGACAAGGCCAACGTTTTGGCGACGAGCAGGCTTTGGAGGAGGGTCATGACGGA
GGTGTTTGCCGCCGAGTTTCCGGATCTGAAGCTTGAGCATCAGCTCATCGACAGTGCGGCCATGCTGTTGGTCAA
GAAGCCCACGCAACTCAACGGCGTGGTCGTCACCAGCAATCTCTTCGGCGATATTGTCAGCGATCAGGTCAGCGC
CATACCCGGAAGTATCGGTCTCCTCCCCAGCGCGAGTATCGGGGGGATTCCGGAGGGGGACAAGGGGTGCAATGG
CATCTACGAGCCCATCCACGGTATCTCATCCCCGATCCTCGAGAGAAGAAAATAAAGGAGCTGAAACGAGGGATA
GGATCCGCACCGGATATCTCGGGCAAGGGCATCGTCAACCCCATCGGCACCATCCTCTCGACGGCCATGCTCCTC
CGTTATAGCCTCGGCCTCCCCGCCGAGGCCCGGGCCGTGGAGGAGGCCGTCAAGGGGGCGCTGGATGGGGGCCTG
CGCACCAGGGATCTGGGGGGGCGATTGGGACGGGGGAGGTGGGGGATGAGGTTTGTAGGAGGCTTGTTGGTGTTT
TGGGGGGGATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail