Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|07088
Gene name
Locationscaffold_09:570700..571096
Strand-
Gene length (bp)396
Transcript length (bp)396
Coding sequence length (bp)396
Protein length (aa) 132

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04479 RTA1 RTA1 like protein 4.6E-12 12 118

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.5

Transmembrane Domains

Domain # Start End Length
1 15 37 22
2 58 80 22
3 95 114 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 6.85 0.52 13.18
Alive In ants, during behavior modification 88.61 35.37 141.84
Dead In ants, recently dead 66.58 27.04 106.12

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.206701 no
Dead Fungus 0.000238 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|07088
MVGSALDTTTGRGAASILLLAGLAVELTTLTAAVAVLVDLWVIRSRSTHPRRFTWRRRISLLALALASLFLVVRC
AYDVADVCRGWLSVLEETTLLIVDGVLTLVVGLVLCVVHAARIPQVSISEETAEQK*
Coding >Ophcf2|07088
ATGGTTGGCAGCGCTTTAGATACCACAACGGGTCGTGGTGCTGCCTCAATCTTGCTCTTGGCTGGCCTTGCGGTG
GAATTGACGACGCTGACTGCTGCCGTGGCCGTCCTGGTCGATCTCTGGGTTATTCGCTCTCGCTCTACTCACCCG
CGGCGCTTCACCTGGCGGCGCAGAATATCGCTACTCGCTCTGGCCCTGGCCTCCCTCTTTCTCGTCGTCCGCTGT
GCCTACGACGTCGCCGACGTGTGCCGTGGCTGGCTGTCGGTGTTGGAAGAGACGACTCTGCTCATCGTTGACGGC
GTCTTGACCCTCGTCGTTGGCTTGGTCCTCTGTGTCGTTCACGCCGCTCGCATCCCCCAGGTGTCCATCTCAGAA
GAAACCGCGGAGCAAAAGTAG
Transcript >Ophcf2|07088
ATGGTTGGCAGCGCTTTAGATACCACAACGGGTCGTGGTGCTGCCTCAATCTTGCTCTTGGCTGGCCTTGCGGTG
GAATTGACGACGCTGACTGCTGCCGTGGCCGTCCTGGTCGATCTCTGGGTTATTCGCTCTCGCTCTACTCACCCG
CGGCGCTTCACCTGGCGGCGCAGAATATCGCTACTCGCTCTGGCCCTGGCCTCCCTCTTTCTCGTCGTCCGCTGT
GCCTACGACGTCGCCGACGTGTGCCGTGGCTGGCTGTCGGTGTTGGAAGAGACGACTCTGCTCATCGTTGACGGC
GTCTTGACCCTCGTCGTTGGCTTGGTCCTCTGTGTCGTTCACGCCGCTCGCATCCCCCAGGTGTCCATCTCAGAA
GAAACCGCGGAGCAAAAGTAG
Gene >Ophcf2|07088
ATGGTTGGCAGCGCTTTAGATACCACAACGGGTCGTGGTGCTGCCTCAATCTTGCTCTTGGCTGGCCTTGCGGTG
GAATTGACGACGCTGACTGCTGCCGTGGCCGTCCTGGTCGATCTCTGGGTTATTCGCTCTCGCTCTACTCACCCG
CGGCGCTTCACCTGGCGGCGCAGAATATCGCTACTCGCTCTGGCCCTGGCCTCCCTCTTTCTCGTCGTCCGCTGT
GCCTACGACGTCGCCGACGTGTGCCGTGGCTGGCTGTCGGTGTTGGAAGAGACGACTCTGCTCATCGTTGACGGC
GTCTTGACCCTCGTCGTTGGCTTGGTCCTCTGTGTCGTTCACGCCGCTCGCATCCCCCAGGTGTCCATCTCAGAA
GAAACCGCGGAGCAAAAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail