Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|07088
Gene name
Locationscaffold_09:570700..571096
Strand-
Gene length (bp)396
Transcript length (bp)396
Coding sequence length (bp)396
Protein length (aa) 132

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04479 RTA1 RTA1 like protein 4.6E-12 12 118

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.5

Transmembrane Domains

Domain # Start End Length
1 15 37 22
2 58 80 22
3 95 114 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|07088
MVGSALDTTTGRGAASILLLAGLAVELTTLTAAVAVLVDLWVIRSRSTHPRRFTWRRRISLLALALASLFLVVRC
AYDVADVCRGWLSVLEETTLLIVDGVLTLVVGLVLCVVHAARIPQVSISEETAEQK*
Coding >Ophcf2|07088
ATGGTTGGCAGCGCTTTAGATACCACAACGGGTCGTGGTGCTGCCTCAATCTTGCTCTTGGCTGGCCTTGCGGTG
GAATTGACGACGCTGACTGCTGCCGTGGCCGTCCTGGTCGATCTCTGGGTTATTCGCTCTCGCTCTACTCACCCG
CGGCGCTTCACCTGGCGGCGCAGAATATCGCTACTCGCTCTGGCCCTGGCCTCCCTCTTTCTCGTCGTCCGCTGT
GCCTACGACGTCGCCGACGTGTGCCGTGGCTGGCTGTCGGTGTTGGAAGAGACGACTCTGCTCATCGTTGACGGC
GTCTTGACCCTCGTCGTTGGCTTGGTCCTCTGTGTCGTTCACGCCGCTCGCATCCCCCAGGTGTCCATCTCAGAA
GAAACCGCGGAGCAAAAGTAG
Transcript >Ophcf2|07088
ATGGTTGGCAGCGCTTTAGATACCACAACGGGTCGTGGTGCTGCCTCAATCTTGCTCTTGGCTGGCCTTGCGGTG
GAATTGACGACGCTGACTGCTGCCGTGGCCGTCCTGGTCGATCTCTGGGTTATTCGCTCTCGCTCTACTCACCCG
CGGCGCTTCACCTGGCGGCGCAGAATATCGCTACTCGCTCTGGCCCTGGCCTCCCTCTTTCTCGTCGTCCGCTGT
GCCTACGACGTCGCCGACGTGTGCCGTGGCTGGCTGTCGGTGTTGGAAGAGACGACTCTGCTCATCGTTGACGGC
GTCTTGACCCTCGTCGTTGGCTTGGTCCTCTGTGTCGTTCACGCCGCTCGCATCCCCCAGGTGTCCATCTCAGAA
GAAACCGCGGAGCAAAAGTAG
Gene >Ophcf2|07088
ATGGTTGGCAGCGCTTTAGATACCACAACGGGTCGTGGTGCTGCCTCAATCTTGCTCTTGGCTGGCCTTGCGGTG
GAATTGACGACGCTGACTGCTGCCGTGGCCGTCCTGGTCGATCTCTGGGTTATTCGCTCTCGCTCTACTCACCCG
CGGCGCTTCACCTGGCGGCGCAGAATATCGCTACTCGCTCTGGCCCTGGCCTCCCTCTTTCTCGTCGTCCGCTGT
GCCTACGACGTCGCCGACGTGTGCCGTGGCTGGCTGTCGGTGTTGGAAGAGACGACTCTGCTCATCGTTGACGGC
GTCTTGACCCTCGTCGTTGGCTTGGTCCTCTGTGTCGTTCACGCCGCTCGCATCCCCCAGGTGTCCATCTCAGAA
GAAACCGCGGAGCAAAAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail