Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|07082
Gene name
Locationscaffold_09:551349..553787
Strand+
Gene length (bp)2438
Transcript length (bp)2232
Coding sequence length (bp)2232
Protein length (aa) 744

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01529 DHHC DHHC palmitoyltransferase 5.0E-34 441 576
PF12796 Ank_2 Ankyrin repeats (3 copies) 1.4E-12 50 143
PF12796 Ank_2 Ankyrin repeats (3 copies) 1.1E-11 150 237
PF00023 Ank Ankyrin repeat 8.6E-06 79 107
PF00023 Ank Ankyrin repeat 9.2E-04 178 209
PF13637 Ank_4 Ankyrin repeats (many copies) 5.0E-06 81 123
PF13637 Ank_4 Ankyrin repeats (many copies) 2.7E-06 115 159
PF13606 Ank_3 Ankyrin repeat 3.4E-07 78 106
PF13857 Ank_5 Ankyrin repeats (many copies) 9.3E-08 203 248

GO

GO Term Description Terminal node
GO:0016409 palmitoyltransferase activity Yes
GO:0005515 protein binding Yes
GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0016746 acyltransferase activity No
GO:0016740 transferase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

Domain # Start End Length
1 293 315 22
2 317 335 18
3 355 377 22
4 390 412 22
5 490 512 22
6 538 560 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|07082
MDSPQRVGSSSAGASPVQPSSKAAAAAPRLNSDVELGRLTSAMATATDIMQLARLGDVTGMERLFESGEFDATFV
DDEGITPLHWAAINNQYAMCSFLIQHGADINRKGGDSVATPLQWAAQRCHYYTVNLLLQHGADPLITDAQGYNTL
HISTFNGNVLLIVLLLHQGIPVDVLDSYGHTALMWAAYKGFPQCVDVFLRWGASVHASDEHGFTALHWALVKGNP
GCVLKLIEYGADRFAKTDTGKTPAVTASELNTQPVWHRALRECGYGHDGHAATPPWPGAGYFLKDKRAFATRFFF
LWPFLLTWAVLLILSRLPVFVAVPATAAVVYGVLWSAREVMEYAPPDMRHFHKTPWMSGIFAGSLFLVGLDWLFV
VLPATARSIKGSSGHVMLNLVFAVLYCLTTFFFVASGRYDPGYVPKLKGIAEQRAAIDELLKEWKYDESSFCVTC
MIRTPLRSKHCRRCQRCVAKHDHHCPWVYNCVGVNNHRHFILYLISLACGILVYDWVLYYYFDGISRDASQSCRL
LSVNLCKMLNADGYTLLLSTWISVQLVWVSMLIFTQFFQLSRGTTTYENMTGIHLGPPGTTTALTSTGAPLDPSM
DDGVNTTTTPGTTTSNPNGNGSTTTINGNATASRPRGPGGLVKQWSRLLGVDPFIETVAGRGAARGSSNRRRRKN
PYSRGCISNCRDFWCDPAPCFGRRDNGAAVLGGAKVDYTAMYESPPLMRLTGMRTRGGGYEAIGTDEV*
Coding >Ophcf2|07082
ATGGACAGCCCCCAGCGCGTCGGCAGCAGCTCGGCGGGCGCGTCGCCGGTACAGCCGTCCTCCAAGGCGGCAGCC
GCAGCGCCTCGTCTCAACAGCGACGTCGAACTCGGCAGGCTGACGTCGGCGATGGCGACGGCGACGGACATCATG
CAGCTGGCGAGGCTGGGCGACGTGACTGGAATGGAGCGTCTGTTCGAATCGGGCGAGTTCGACGCGACCTTTGTC
GATGACGAGGGCATCACGCCCCTGCACTGGGCGGCCATTAACAATCAGTACGCCATGTGCAGCTTTCTCATCCAG
CACGGGGCCGATATCAATCGAAAGGGCGGCGATTCGGTGGCCACGCCGCTGCAATGGGCCGCTCAGCGATGCCAT
TACTATACCGTCAACCTGCTCCTCCAGCACGGGGCCGATCCCCTGATAACCGACGCTCAGGGCTACAACACGCTG
CACATCTCGACCTTTAACGGAAACGTGCTGCTCATCGTCCTGCTGCTGCACCAGGGCATCCCCGTCGACGTCCTG
GACAGCTACGGACACACGGCTCTCATGTGGGCCGCCTACAAGGGCTTCCCCCAGTGCGTCGACGTCTTCTTGCGA
TGGGGCGCCAGCGTTCATGCCTCGGACGAGCACGGCTTCACCGCCCTGCACTGGGCCCTCGTCAAGGGCAACCCG
GGATGCGTCCTCAAGCTGATCGAGTACGGAGCCGATCGGTTCGCCAAGACGGACACGGGAAAGACGCCGGCCGTC
ACGGCCAGCGAGCTCAACACGCAGCCCGTCTGGCATCGAGCCCTTCGCGAGTGCGGCTACGGTCATGACGGACAC
GCCGCCACGCCGCCTTGGCCCGGCGCTGGTTACTTTCTCAAGGACAAGCGCGCCTTCGCCACCCGCTTCTTCTTC
CTATGGCCCTTTCTCCTGACTTGGGCTGTCCTGCTCATCCTCTCTCGGCTGCCCGTCTTCGTGGCCGTTCCCGCT
ACGGCTGCTGTCGTGTATGGCGTCTTGTGGTCCGCGCGCGAGGTGATGGAGTATGCGCCGCCTGATATGCGACAC
TTTCACAAGACGCCCTGGATGTCGGGCATCTTTGCCGGCTCCCTCTTCCTCGTCGGCCTCGACTGGCTCTTCGTC
GTTCTACCAGCCACGGCGCGCTCAATCAAAGGATCGTCCGGTCACGTCATGCTCAACCTCGTCTTCGCCGTCCTC
TACTGCCTGACGACCTTTTTCTTCGTCGCCAGCGGCCGATACGATCCCGGGTACGTGCCCAAGCTCAAGGGCATC
GCCGAGCAGCGGGCCGCCATCGACGAGCTGCTCAAGGAGTGGAAGTACGACGAGTCGAGCTTCTGCGTCACCTGC
ATGATCCGCACGCCTCTCCGGAGCAAGCATTGCCGCCGCTGTCAGCGCTGTGTGGCCAAGCACGATCACCACTGC
CCCTGGGTATACAACTGCGTGGGCGTCAACAACCACCGGCACTTTATCCTCTACCTCATCAGCCTCGCCTGTGGC
ATCCTCGTCTACGACTGGGTCTTGTACTACTACTTTGATGGCATATCCCGAGACGCGTCGCAGAGCTGTCGCTTG
CTGAGCGTCAACCTCTGCAAGATGCTCAACGCCGACGGATACACGCTGCTGCTGTCGACTTGGATCTCCGTCCAG
CTCGTCTGGGTCTCGATGCTCATCTTTACCCAGTTCTTCCAGCTCTCACGCGGCACCACGACGTACGAGAACATG
ACGGGCATCCACCTCGGGCCCCCGGGGACGACGACGGCCCTCACCTCGACCGGCGCCCCGCTAGATCCCAGCATG
GACGACGGCGTCAACACGACGACGACGCCCGGCACCACGACCAGCAACCCCAACGGCAACGGCTCCACGACCACC
ATCAACGGCAACGCCACGGCCTCTCGTCCCCGCGGCCCGGGCGGCCTCGTCAAGCAATGGAGCCGCCTCCTGGGC
GTAGACCCCTTCATCGAGACGGTCGCCGGCCGAGGCGCCGCCCGCGGCTCCTCCAACCGCCGCCGCAGAAAGAAC
CCCTACAGCCGGGGCTGCATCTCCAACTGCCGCGACTTCTGGTGCGATCCCGCCCCGTGTTTCGGCCGCCGCGAC
AACGGGGCTGCCGTCCTGGGCGGCGCAAAGGTCGACTACACGGCCATGTACGAGAGTCCGCCCCTGATGCGGCTG
ACGGGCATGAGGACCAGGGGAGGGGGGTATGAGGCCATCGGCACGGATGAGGTTTAG
Transcript >Ophcf2|07082
ATGGACAGCCCCCAGCGCGTCGGCAGCAGCTCGGCGGGCGCGTCGCCGGTACAGCCGTCCTCCAAGGCGGCAGCC
GCAGCGCCTCGTCTCAACAGCGACGTCGAACTCGGCAGGCTGACGTCGGCGATGGCGACGGCGACGGACATCATG
CAGCTGGCGAGGCTGGGCGACGTGACTGGAATGGAGCGTCTGTTCGAATCGGGCGAGTTCGACGCGACCTTTGTC
GATGACGAGGGCATCACGCCCCTGCACTGGGCGGCCATTAACAATCAGTACGCCATGTGCAGCTTTCTCATCCAG
CACGGGGCCGATATCAATCGAAAGGGCGGCGATTCGGTGGCCACGCCGCTGCAATGGGCCGCTCAGCGATGCCAT
TACTATACCGTCAACCTGCTCCTCCAGCACGGGGCCGATCCCCTGATAACCGACGCTCAGGGCTACAACACGCTG
CACATCTCGACCTTTAACGGAAACGTGCTGCTCATCGTCCTGCTGCTGCACCAGGGCATCCCCGTCGACGTCCTG
GACAGCTACGGACACACGGCTCTCATGTGGGCCGCCTACAAGGGCTTCCCCCAGTGCGTCGACGTCTTCTTGCGA
TGGGGCGCCAGCGTTCATGCCTCGGACGAGCACGGCTTCACCGCCCTGCACTGGGCCCTCGTCAAGGGCAACCCG
GGATGCGTCCTCAAGCTGATCGAGTACGGAGCCGATCGGTTCGCCAAGACGGACACGGGAAAGACGCCGGCCGTC
ACGGCCAGCGAGCTCAACACGCAGCCCGTCTGGCATCGAGCCCTTCGCGAGTGCGGCTACGGTCATGACGGACAC
GCCGCCACGCCGCCTTGGCCCGGCGCTGGTTACTTTCTCAAGGACAAGCGCGCCTTCGCCACCCGCTTCTTCTTC
CTATGGCCCTTTCTCCTGACTTGGGCTGTCCTGCTCATCCTCTCTCGGCTGCCCGTCTTCGTGGCCGTTCCCGCT
ACGGCTGCTGTCGTGTATGGCGTCTTGTGGTCCGCGCGCGAGGTGATGGAGTATGCGCCGCCTGATATGCGACAC
TTTCACAAGACGCCCTGGATGTCGGGCATCTTTGCCGGCTCCCTCTTCCTCGTCGGCCTCGACTGGCTCTTCGTC
GTTCTACCAGCCACGGCGCGCTCAATCAAAGGATCGTCCGGTCACGTCATGCTCAACCTCGTCTTCGCCGTCCTC
TACTGCCTGACGACCTTTTTCTTCGTCGCCAGCGGCCGATACGATCCCGGGTACGTGCCCAAGCTCAAGGGCATC
GCCGAGCAGCGGGCCGCCATCGACGAGCTGCTCAAGGAGTGGAAGTACGACGAGTCGAGCTTCTGCGTCACCTGC
ATGATCCGCACGCCTCTCCGGAGCAAGCATTGCCGCCGCTGTCAGCGCTGTGTGGCCAAGCACGATCACCACTGC
CCCTGGGTATACAACTGCGTGGGCGTCAACAACCACCGGCACTTTATCCTCTACCTCATCAGCCTCGCCTGTGGC
ATCCTCGTCTACGACTGGGTCTTGTACTACTACTTTGATGGCATATCCCGAGACGCGTCGCAGAGCTGTCGCTTG
CTGAGCGTCAACCTCTGCAAGATGCTCAACGCCGACGGATACACGCTGCTGCTGTCGACTTGGATCTCCGTCCAG
CTCGTCTGGGTCTCGATGCTCATCTTTACCCAGTTCTTCCAGCTCTCACGCGGCACCACGACGTACGAGAACATG
ACGGGCATCCACCTCGGGCCCCCGGGGACGACGACGGCCCTCACCTCGACCGGCGCCCCGCTAGATCCCAGCATG
GACGACGGCGTCAACACGACGACGACGCCCGGCACCACGACCAGCAACCCCAACGGCAACGGCTCCACGACCACC
ATCAACGGCAACGCCACGGCCTCTCGTCCCCGCGGCCCGGGCGGCCTCGTCAAGCAATGGAGCCGCCTCCTGGGC
GTAGACCCCTTCATCGAGACGGTCGCCGGCCGAGGCGCCGCCCGCGGCTCCTCCAACCGCCGCCGCAGAAAGAAC
CCCTACAGCCGGGGCTGCATCTCCAACTGCCGCGACTTCTGGTGCGATCCCGCCCCGTGTTTCGGCCGCCGCGAC
AACGGGGCTGCCGTCCTGGGCGGCGCAAAGGTCGACTACACGGCCATGTACGAGAGTCCGCCCCTGATGCGGCTG
ACGGGCATGAGGACCAGGGGAGGGGGGTATGAGGCCATCGGCACGGATGAGGTTTAG
Gene >Ophcf2|07082
ATGGACAGCCCCCAGCGCGTCGGCAGCAGCTCGGCGGGCGCGTCGCCGGTACAGCCGTCCTCCAAGGCGGCAGCC
GCAGCGCCTCGTCTCAACAGCGACGTCGAACTCGGCAGGCTGACGTCGGCGATGGCGACGGCGACGGACATCATG
CAGCTGGCGAGGCTGGGCGACGTGACTGGAATGGAGCGTCTGTTCGAATCGGGCGAGTTCGACGCGACCTTTGTC
GATGACGAGGGCATCACGCCCCTGCACGTGAGGAGCTGAACGAAGCATCGACTGGCTGGCGGCTGACGGCGTCTC
TACCCAGTGGGCGGCCATTAACAATCAGTACGCCATGTGCAGCTTTCTCATCCAGCACGGGGCCGATATCAATCG
AAAGGGCGGCGATTCGGTGGCCACGCCGCTGCAATGGGCCGCTCAGCGATGCCATTACTATACCGTCAACCTGCT
CCTCCAGCACGGGGCCGATCCCCTGATAACCGACGCTCAGGGCTACAACACGCTGCACATCTCGACCTTTAACGG
AAACGTGCTGCTCATCGTCCTGCTGCTGCACCAGGGCATCCCCGTCGACGTCCTGGACAGCTACGGACACACGGC
TCTCATGTGGGCCGCCTACAAGGGCTTCCCCCAGTGCGTCGACGTCTTCTTGCGATGGGGCGCCAGCGTTCATGC
CTCGGACGAGCACGGCTTCACCGCCCTGCACTGGGCCCTCGTCAAGGGCAACCCGGGATGCGTCCTCAAGCTGAT
CGAGTACGGAGCCGATCGGTTCGCCAAGACGGACACGGGAAAGACGCCGGCCGTCACGGCCAGCGAGCTCAACAC
GCAGCCCGTCTGGCATCGAGCCCTTCGCGAGTGCGGCTACGGTCATGACGGACACGCCGCCACGCCGCCTTGGCC
CGGCGCTGGTTACTTTCTCAAGGACAAGCGCGCCTTCGCCACCCGCTTCTTCTTCCTATGGCCCTTTCTCCTGAC
TTGGGCTGTCCTGCTCATCCTCTCTCGGCTGCCCGTCTTCGTGGCCGTTCCCGCTACGGCTGCTGTCGTGTATGG
CGTCTTGTGGTCCGCGCGCGAGGTGATGGAGTATGCGCCGCCTGATATGCGACACTTTCACAAGACGGTATGACT
TCCTTCTTTTTTCTTCTTGACCCCGTGTGTCTCCGTGTCAGACTCTGAAAGCTCCTTCTCTCTCTCTCTCCCTCT
CTCTCTCTCTAAAGCCCTGGATGTCGGGCATCTTTGCCGGCTCCCTCTTCCTCGTCGGCCTCGACTGGCTCTTCG
TCGTTCTACCAGCCACGGCGCGCTCAATCAAAGGATCGTCCGGTCACGTCATGCTCAACCTCGTCTTCGCCGTCC
TCTACTGCCTGACGACCTTTTTCTTCGTCGCCAGCGGCCGATACGATCCCGGGTACGTGCCCAAGCTCAAGGGCA
TCGCCGAGCAGCGGGCCGCCATCGACGAGCTGCTCAAGGAGTGGAAGTACGACGAGTCGAGCTTCTGCGTCACCT
GCATGATCCGCACGCCTCTCCGGAGCAAGCATTGCCGCCGCTGTCAGCGCTGTGTGGCCAAGCACGATCACCACT
GCCCCTGGGTATACAACTGCGTGGGCGTCAACAACCACCGGCACTTTATCCTCTACCTCATCAGCCTCGCCTGTG
GCATCCTCGTCTACGACTGGGTCTTGTACTACTGTGAGCTTCCTCCCCGTCGACTTGTGTGAGGGGTTGACGCCG
ACTCGACAGCAGACTTTGATGGCATATCCCGAGACGCGTCGCAGAGCTGTCGCTTGCTGAGCGTCAACCTCTGCA
AGATGCTCAACGCCGACGGATACACGCTGCTGCTGTCGACTTGGATCTCCGTCCAGCTCGTCTGGGTCTCGATGC
TCATCTTTACCCAGTTCTTCCAGCTCTCACGCGGCACCACGACGTACGAGAACATGACGGGCATCCACCTCGGGC
CCCCGGGGACGACGACGGCCCTCACCTCGACCGGCGCCCCGCTAGATCCCAGCATGGACGACGGCGTCAACACGA
CGACGACGCCCGGCACCACGACCAGCAACCCCAACGGCAACGGCTCCACGACCACCATCAACGGCAACGCCACGG
CCTCTCGTCCCCGCGGCCCGGGCGGCCTCGTCAAGCAATGGAGCCGCCTCCTGGGCGTAGACCCCTTCATCGAGA
CGGTCGCCGGCCGAGGCGCCGCCCGCGGCTCCTCCAACCGCCGCCGCAGAAAGAACCCCTACAGCCGGGGCTGCA
TCTCCAACTGCCGCGACTTCTGGTGCGATCCCGCCCCGTGTTTCGGCCGCCGCGACAACGGGGCTGCCGTCCTGG
GCGGCGCAAAGGTCGACTACACGGCCATGTACGAGAGTCCGCCCCTGATGCGGCTGACGGGCATGAGGACCAGGG
GAGGGGGGTATGAGGCCATCGGCACGGATGAGGTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail