Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|07052
Gene name
Locationscaffold_09:473091..477660
Strand-
Gene length (bp)4569
Transcript length (bp)4389
Coding sequence length (bp)4389
Protein length (aa) 1463

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13254 DUF4045 Domain of unknown function (DUF4045) 5.9E-52 276 471
PF13254 DUF4045 Domain of unknown function (DUF4045) 7.3E-36 503 619

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.8178 0.3114 0.2157 0.1622 0.118 0.0418 0.0321 0.0868 0.079 0.0449

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2690
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2131
Ophiocordyceps australis map64 (Brazil) OphauB2|5708
Ophiocordyceps camponoti-floridani Ophcf2|07052 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|7248
Ophiocordyceps kimflemingae Ophio5|7826
Ophiocordyceps subramaniannii Hirsu2|4197

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|07052
MSDEVSQFLEQVERLRGQQAGEDETRARELEDYLAAKRERQARREERARSISPQKSSPVNTPSPRSNRRAGQQSS
DRLESPTTLADKQHLDLSSLPLSMEPLGSPTKENEAPLDSTEAKRVSTADSRSSTLSWQRRPNSRPLSMVAAQNA
TQRSLAGTQDSSTLDQAAVSHEQMAQTLASKDPSRFRQTDDRGIGSADNRRSQVDDDDRLDMTSAKTHQLSGMTI
ETPRRPSSPTPARLGSPVALKPHRPEHLSIDDKPFIEPGVTSPPGRTSPIRSTSPTKGVGGFVQSAMMKRSDSVK
RWSVTSPPGLTRAESVAANRNSHDRTSSSIGSRPTSGHSHAGASSRPTSSQGEEETVAQTSPEPQKKSDRASKPD
QTSKPDDIAVPSSPTKTMDPRRWSPTKSSWLESALNRPESPTKTQPKPKAQPAWMVELNKARAERANSQGMDTSR
NVTHKHQVSIGGLMRQSPVGEVAKTNPTGLGGIYSPPPASTTPSFTTRPVLGHESKPSFAESIASETGDVDGQKR
RPSGFLPQTKPKPEAVQNKDFRAGLRQRPAGADGTKSGEPEFKNVFGNLRRTRTQNYVAPDELKDNILRGKAALS
ITDGPRKNEQRDDFKEAIQKKREDFKKAQVDGKGVTRSSSGDGGKQPLEGVAKRFELKRSTTGSSNGSRKGSLAA
ERSPKDEAQESSSSSANASPTMETTPQKNQAAPPRVAPPPSDKPLSEQPTRRGSGDMEATKPVEASSTTTRAGAK
KLAGRLNPALAGMLARGPPPMAATNGADGSGGQSSSAAGDGSEPTAAGPQLTHMTKSRARGPKRKAPTSSAAPSP
SIGVGSDLTKEPKGPMEQVPSPDPAEKPAVPLSIQQRVAAQAALRSRGKPDSGSSSAADESPAPVPAAVANKTTT
DGGKDAGLKVDVVKASRLFNETTAGTAQPAASSIHRRTGSRSPTKQSSAVRDDSQASLPSTRPKTTPGEKGAEPS
RKVDVKRASRIFDEKTAGTAQPVASPLHRRTGSRSPTKQTMADAPDAAPKSSASRPTTPLTKSTLSAEAVKSPSR
APSSPGKATNELSKLLIDFFGPPVPRKEMRVDTAELLMSRPTGGSGKITSLGFQMFRIFGDGKKVPVSAQNERVL
FEQDMYVCAHNFTNEAGKKMFEIYFWVGDEVGEATAQDAQLFVQREAKSLGGTLVRLRQGRETAEFLAALGGVVM
VRRGTSNKYDSLAPNMLCGRRYLGQVAFDEVDFAPSSLCSGFTYLMAQAGKCFLWKGKGSDVAEISCARLVGIDL
SLTGELIECDDGSEPAAFWDMFDKESPRPQSAAHWRLKPSYDKYRSRLFCSEAGSDAQMYEMHPFVQADLSPSHI
YVLDAFFELYIIIGSKANNQYASFRNALDFAQEYAILAAGIEDRPFVPVSSVVLEGAPRDLKRVFRKWDDKRSPT
AAAAAAPMPAASSGSLRRGRSLKVVTLTQALQAVSSD*
Coding >Ophcf2|07052
ATGTCCGACGAGGTGTCGCAGTTCCTCGAGCAGGTCGAGCGTCTGCGCGGACAGCAAGCCGGAGAGGACGAGACG
AGAGCCCGTGAGCTGGAGGACTATCTGGCTGCTAAGCGGGAACGCCAGGCCCGCAGAGAAGAACGCGCTCGATCC
ATTTCACCCCAGAAGTCGTCTCCCGTAAACACGCCGTCCCCCCGTTCCAACCGTCGAGCCGGCCAGCAGTCGTCC
GATAGGCTCGAGTCTCCCACCACGCTCGCCGACAAGCAACACCTTGATCTCTCCTCTCTTCCCCTCTCCATGGAA
CCGCTGGGGTCGCCGACCAAGGAGAACGAGGCGCCGCTGGACTCGACCGAAGCTAAGCGTGTGTCGACGGCCGAC
TCCAGATCTTCCACCCTGTCCTGGCAGAGGAGGCCCAATTCTCGACCCCTGAGCATGGTTGCCGCTCAGAACGCG
ACGCAGAGGTCGCTCGCTGGGACTCAGGACTCTTCCACCTTGGACCAGGCAGCTGTCTCTCATGAGCAGATGGCA
CAGACTCTCGCCTCCAAAGATCCGTCTCGGTTTCGTCAGACGGACGATCGGGGCATCGGCTCGGCAGACAACCGA
CGCAGCCAGGTCGACGACGACGACCGCCTCGACATGACGTCGGCCAAGACGCACCAGCTATCGGGCATGACGATC
GAGACGCCCCGTCGTCCATCGTCCCCGACTCCAGCCAGACTAGGCTCTCCCGTTGCCCTGAAGCCGCATCGACCC
GAGCATCTCTCGATCGACGACAAGCCCTTTATCGAGCCGGGAGTCACCTCGCCGCCCGGCAGGACATCTCCCATC
CGCTCGACGTCTCCCACGAAGGGTGTCGGCGGCTTCGTTCAGAGTGCCATGATGAAGCGAAGCGATAGTGTCAAG
CGATGGAGCGTCACCAGCCCTCCAGGCTTGACCCGTGCCGAGTCCGTTGCTGCCAACCGTAATTCTCACGACCGA
ACCTCTTCGAGCATTGGGTCGCGGCCGACGAGCGGTCATTCTCATGCTGGGGCTTCGAGCAGGCCGACATCGAGT
CAAGGCGAGGAAGAGACCGTCGCGCAAACGTCACCGGAACCGCAGAAGAAGTCAGACCGGGCCTCGAAGCCGGAC
CAGACCTCGAAACCGGACGACATTGCCGTTCCATCCTCGCCCACCAAGACGATGGATCCGCGCCGCTGGAGCCCG
ACCAAGTCGAGCTGGCTTGAGAGCGCTCTCAACAGGCCCGAGTCGCCGACCAAGACGCAGCCGAAACCCAAGGCG
CAGCCAGCGTGGATGGTCGAGCTCAACAAGGCTCGGGCCGAACGCGCAAACAGCCAAGGCATGGACACCTCGCGT
AACGTCACGCACAAGCATCAGGTCAGCATCGGCGGCCTTATGAGGCAGTCGCCCGTCGGCGAGGTGGCCAAGACG
AATCCAACGGGGCTCGGCGGCATCTACTCTCCGCCTCCTGCGAGCACGACGCCATCCTTCACCACCCGGCCGGTT
CTGGGCCATGAGTCGAAGCCTAGCTTCGCGGAGAGCATCGCCAGCGAGACAGGCGACGTCGATGGCCAGAAGCGA
CGGCCTTCGGGCTTTCTGCCCCAGACCAAGCCCAAGCCCGAAGCCGTACAGAACAAAGACTTCCGGGCCGGCCTC
CGACAACGGCCGGCCGGCGCCGACGGCACCAAGAGCGGCGAGCCAGAGTTCAAGAACGTCTTTGGCAACCTGCGC
CGGACCAGGACTCAAAACTATGTGGCTCCGGACGAGCTCAAGGACAACATTCTCCGGGGAAAGGCCGCGCTCAGC
ATCACGGATGGTCCTCGCAAGAACGAGCAGCGGGACGACTTTAAGGAAGCCATCCAGAAGAAGCGCGAAGACTTC
AAGAAAGCCCAAGTCGACGGCAAGGGCGTGACGAGAAGCTCTAGCGGCGACGGTGGGAAGCAGCCGCTCGAGGGT
GTGGCCAAGAGGTTCGAGCTCAAGAGGTCGACAACCGGATCCTCGAATGGATCCAGAAAGGGGAGCCTCGCAGCC
GAGAGGAGCCCCAAGGACGAGGCCCAAGAGTCTTCGTCTTCCTCGGCCAACGCGTCTCCGACGATGGAAACCACG
CCTCAGAAGAATCAGGCGGCTCCCCCGAGAGTGGCGCCGCCACCATCCGATAAGCCTCTTTCAGAGCAGCCAACG
CGACGGGGTTCGGGCGACATGGAGGCCACGAAGCCGGTGGAGGCCTCATCCACGACGACACGTGCTGGGGCCAAG
AAGCTTGCGGGTCGTCTCAACCCGGCCCTGGCGGGGATGCTGGCTAGAGGACCGCCTCCCATGGCAGCCACCAAC
GGGGCCGACGGCTCCGGTGGCCAATCGAGCTCAGCTGCCGGTGACGGGTCGGAGCCGACTGCTGCCGGGCCTCAG
CTCACCCACATGACCAAGTCTCGGGCACGCGGCCCTAAGAGGAAAGCCCCGACTTCGTCAGCGGCACCATCCCCG
AGCATCGGCGTCGGATCGGATCTAACCAAGGAGCCCAAGGGGCCCATGGAGCAAGTGCCGTCACCCGACCCTGCG
GAGAAACCGGCCGTCCCTCTGTCGATACAGCAGCGGGTGGCGGCCCAGGCAGCGCTTCGCAGCCGCGGCAAGCCG
GACAGCGGCAGCTCATCGGCAGCGGACGAGAGCCCGGCGCCTGTACCTGCTGCTGTGGCGAACAAGACGACGACG
GATGGCGGGAAAGACGCCGGCCTCAAGGTGGACGTGGTGAAAGCATCACGACTCTTTAATGAAACGACGGCGGGA
ACTGCCCAACCCGCGGCATCGTCGATTCACCGGCGTACTGGATCTCGGTCTCCGACAAAGCAGAGCTCAGCGGTC
AGGGACGATAGCCAAGCTTCTCTGCCCAGCACGAGGCCAAAGACGACGCCTGGTGAAAAGGGGGCCGAGCCCAGC
CGCAAGGTAGATGTGAAGAGGGCATCGCGGATCTTTGACGAAAAGACGGCGGGCACTGCCCAACCCGTAGCGTCG
CCTCTTCACCGGCGCACGGGTTCGCGATCCCCGACCAAGCAGACAATGGCCGATGCCCCCGACGCGGCTCCTAAG
AGCAGCGCCTCGAGACCAACGACGCCGCTGACAAAGTCGACGCTCTCCGCAGAAGCCGTCAAGAGTCCCTCGAGG
GCCCCCTCGTCTCCCGGCAAAGCGACCAACGAGTTGTCGAAGCTGTTGATCGACTTCTTCGGCCCGCCAGTTCCT
CGCAAGGAGATGCGTGTAGACACGGCGGAACTACTGATGAGCCGACCAACAGGCGGGTCGGGCAAGATTACCAGC
CTGGGCTTCCAGATGTTCCGCATCTTCGGCGACGGTAAGAAAGTGCCGGTTTCGGCGCAGAACGAGCGGGTGCTG
TTCGAGCAAGACATGTACGTGTGCGCGCACAACTTCACCAACGAGGCCGGTAAGAAGATGTTCGAGATCTACTTC
TGGGTGGGCGACGAGGTTGGCGAAGCGACGGCTCAAGACGCTCAGTTGTTTGTTCAGCGCGAGGCCAAGTCGCTG
GGCGGGACGCTGGTTCGTCTGAGGCAGGGCAGGGAGACTGCCGAGTTCCTGGCAGCGCTCGGGGGCGTCGTCATG
GTGCGTCGTGGAACGAGCAACAAGTACGACTCGCTGGCGCCCAACATGCTGTGCGGAAGACGCTATCTGGGCCAG
GTGGCCTTTGACGAGGTCGACTTTGCGCCGTCGAGCCTGTGCTCTGGCTTCACCTACCTCATGGCCCAGGCCGGC
AAGTGTTTTCTCTGGAAGGGCAAGGGCAGCGACGTGGCCGAGATCAGCTGTGCGAGGCTCGTCGGCATCGACCTC
AGCCTGACGGGCGAGCTGATTGAGTGCGACGACGGGAGCGAACCGGCTGCCTTCTGGGACATGTTTGATAAGGAG
AGCCCGAGGCCGCAGTCGGCGGCGCACTGGAGGCTGAAGCCGAGCTACGACAAGTACCGGAGCCGGCTGTTTTGC
TCGGAGGCCGGTTCGGATGCGCAGATGTACGAAATGCACCCCTTCGTCCAAGCAGACCTCTCCCCCTCACACATC
TACGTCCTCGACGCCTTCTTCGAGCTCTACATCATCATCGGCTCCAAAGCCAACAACCAATACGCCTCCTTCCGT
AACGCCCTCGACTTCGCGCAAGAATACGCCATCCTAGCCGCCGGCATCGAGGACCGACCCTTCGTTCCCGTCTCG
TCCGTCGTGCTCGAGGGCGCGCCCCGTGACCTCAAGCGCGTATTCCGCAAGTGGGATGATAAGAGGAGCCCGACG
GCTGCTGCTGCTGCTGCTCCGATGCCGGCGGCTTCGTCTGGGTCGCTGAGGAGGGGGAGGAGCTTGAAGGTTGTG
ACGCTTACGCAGGCTCTTCAGGCTGTCAGCAGCGATTGA
Transcript >Ophcf2|07052
ATGTCCGACGAGGTGTCGCAGTTCCTCGAGCAGGTCGAGCGTCTGCGCGGACAGCAAGCCGGAGAGGACGAGACG
AGAGCCCGTGAGCTGGAGGACTATCTGGCTGCTAAGCGGGAACGCCAGGCCCGCAGAGAAGAACGCGCTCGATCC
ATTTCACCCCAGAAGTCGTCTCCCGTAAACACGCCGTCCCCCCGTTCCAACCGTCGAGCCGGCCAGCAGTCGTCC
GATAGGCTCGAGTCTCCCACCACGCTCGCCGACAAGCAACACCTTGATCTCTCCTCTCTTCCCCTCTCCATGGAA
CCGCTGGGGTCGCCGACCAAGGAGAACGAGGCGCCGCTGGACTCGACCGAAGCTAAGCGTGTGTCGACGGCCGAC
TCCAGATCTTCCACCCTGTCCTGGCAGAGGAGGCCCAATTCTCGACCCCTGAGCATGGTTGCCGCTCAGAACGCG
ACGCAGAGGTCGCTCGCTGGGACTCAGGACTCTTCCACCTTGGACCAGGCAGCTGTCTCTCATGAGCAGATGGCA
CAGACTCTCGCCTCCAAAGATCCGTCTCGGTTTCGTCAGACGGACGATCGGGGCATCGGCTCGGCAGACAACCGA
CGCAGCCAGGTCGACGACGACGACCGCCTCGACATGACGTCGGCCAAGACGCACCAGCTATCGGGCATGACGATC
GAGACGCCCCGTCGTCCATCGTCCCCGACTCCAGCCAGACTAGGCTCTCCCGTTGCCCTGAAGCCGCATCGACCC
GAGCATCTCTCGATCGACGACAAGCCCTTTATCGAGCCGGGAGTCACCTCGCCGCCCGGCAGGACATCTCCCATC
CGCTCGACGTCTCCCACGAAGGGTGTCGGCGGCTTCGTTCAGAGTGCCATGATGAAGCGAAGCGATAGTGTCAAG
CGATGGAGCGTCACCAGCCCTCCAGGCTTGACCCGTGCCGAGTCCGTTGCTGCCAACCGTAATTCTCACGACCGA
ACCTCTTCGAGCATTGGGTCGCGGCCGACGAGCGGTCATTCTCATGCTGGGGCTTCGAGCAGGCCGACATCGAGT
CAAGGCGAGGAAGAGACCGTCGCGCAAACGTCACCGGAACCGCAGAAGAAGTCAGACCGGGCCTCGAAGCCGGAC
CAGACCTCGAAACCGGACGACATTGCCGTTCCATCCTCGCCCACCAAGACGATGGATCCGCGCCGCTGGAGCCCG
ACCAAGTCGAGCTGGCTTGAGAGCGCTCTCAACAGGCCCGAGTCGCCGACCAAGACGCAGCCGAAACCCAAGGCG
CAGCCAGCGTGGATGGTCGAGCTCAACAAGGCTCGGGCCGAACGCGCAAACAGCCAAGGCATGGACACCTCGCGT
AACGTCACGCACAAGCATCAGGTCAGCATCGGCGGCCTTATGAGGCAGTCGCCCGTCGGCGAGGTGGCCAAGACG
AATCCAACGGGGCTCGGCGGCATCTACTCTCCGCCTCCTGCGAGCACGACGCCATCCTTCACCACCCGGCCGGTT
CTGGGCCATGAGTCGAAGCCTAGCTTCGCGGAGAGCATCGCCAGCGAGACAGGCGACGTCGATGGCCAGAAGCGA
CGGCCTTCGGGCTTTCTGCCCCAGACCAAGCCCAAGCCCGAAGCCGTACAGAACAAAGACTTCCGGGCCGGCCTC
CGACAACGGCCGGCCGGCGCCGACGGCACCAAGAGCGGCGAGCCAGAGTTCAAGAACGTCTTTGGCAACCTGCGC
CGGACCAGGACTCAAAACTATGTGGCTCCGGACGAGCTCAAGGACAACATTCTCCGGGGAAAGGCCGCGCTCAGC
ATCACGGATGGTCCTCGCAAGAACGAGCAGCGGGACGACTTTAAGGAAGCCATCCAGAAGAAGCGCGAAGACTTC
AAGAAAGCCCAAGTCGACGGCAAGGGCGTGACGAGAAGCTCTAGCGGCGACGGTGGGAAGCAGCCGCTCGAGGGT
GTGGCCAAGAGGTTCGAGCTCAAGAGGTCGACAACCGGATCCTCGAATGGATCCAGAAAGGGGAGCCTCGCAGCC
GAGAGGAGCCCCAAGGACGAGGCCCAAGAGTCTTCGTCTTCCTCGGCCAACGCGTCTCCGACGATGGAAACCACG
CCTCAGAAGAATCAGGCGGCTCCCCCGAGAGTGGCGCCGCCACCATCCGATAAGCCTCTTTCAGAGCAGCCAACG
CGACGGGGTTCGGGCGACATGGAGGCCACGAAGCCGGTGGAGGCCTCATCCACGACGACACGTGCTGGGGCCAAG
AAGCTTGCGGGTCGTCTCAACCCGGCCCTGGCGGGGATGCTGGCTAGAGGACCGCCTCCCATGGCAGCCACCAAC
GGGGCCGACGGCTCCGGTGGCCAATCGAGCTCAGCTGCCGGTGACGGGTCGGAGCCGACTGCTGCCGGGCCTCAG
CTCACCCACATGACCAAGTCTCGGGCACGCGGCCCTAAGAGGAAAGCCCCGACTTCGTCAGCGGCACCATCCCCG
AGCATCGGCGTCGGATCGGATCTAACCAAGGAGCCCAAGGGGCCCATGGAGCAAGTGCCGTCACCCGACCCTGCG
GAGAAACCGGCCGTCCCTCTGTCGATACAGCAGCGGGTGGCGGCCCAGGCAGCGCTTCGCAGCCGCGGCAAGCCG
GACAGCGGCAGCTCATCGGCAGCGGACGAGAGCCCGGCGCCTGTACCTGCTGCTGTGGCGAACAAGACGACGACG
GATGGCGGGAAAGACGCCGGCCTCAAGGTGGACGTGGTGAAAGCATCACGACTCTTTAATGAAACGACGGCGGGA
ACTGCCCAACCCGCGGCATCGTCGATTCACCGGCGTACTGGATCTCGGTCTCCGACAAAGCAGAGCTCAGCGGTC
AGGGACGATAGCCAAGCTTCTCTGCCCAGCACGAGGCCAAAGACGACGCCTGGTGAAAAGGGGGCCGAGCCCAGC
CGCAAGGTAGATGTGAAGAGGGCATCGCGGATCTTTGACGAAAAGACGGCGGGCACTGCCCAACCCGTAGCGTCG
CCTCTTCACCGGCGCACGGGTTCGCGATCCCCGACCAAGCAGACAATGGCCGATGCCCCCGACGCGGCTCCTAAG
AGCAGCGCCTCGAGACCAACGACGCCGCTGACAAAGTCGACGCTCTCCGCAGAAGCCGTCAAGAGTCCCTCGAGG
GCCCCCTCGTCTCCCGGCAAAGCGACCAACGAGTTGTCGAAGCTGTTGATCGACTTCTTCGGCCCGCCAGTTCCT
CGCAAGGAGATGCGTGTAGACACGGCGGAACTACTGATGAGCCGACCAACAGGCGGGTCGGGCAAGATTACCAGC
CTGGGCTTCCAGATGTTCCGCATCTTCGGCGACGGTAAGAAAGTGCCGGTTTCGGCGCAGAACGAGCGGGTGCTG
TTCGAGCAAGACATGTACGTGTGCGCGCACAACTTCACCAACGAGGCCGGTAAGAAGATGTTCGAGATCTACTTC
TGGGTGGGCGACGAGGTTGGCGAAGCGACGGCTCAAGACGCTCAGTTGTTTGTTCAGCGCGAGGCCAAGTCGCTG
GGCGGGACGCTGGTTCGTCTGAGGCAGGGCAGGGAGACTGCCGAGTTCCTGGCAGCGCTCGGGGGCGTCGTCATG
GTGCGTCGTGGAACGAGCAACAAGTACGACTCGCTGGCGCCCAACATGCTGTGCGGAAGACGCTATCTGGGCCAG
GTGGCCTTTGACGAGGTCGACTTTGCGCCGTCGAGCCTGTGCTCTGGCTTCACCTACCTCATGGCCCAGGCCGGC
AAGTGTTTTCTCTGGAAGGGCAAGGGCAGCGACGTGGCCGAGATCAGCTGTGCGAGGCTCGTCGGCATCGACCTC
AGCCTGACGGGCGAGCTGATTGAGTGCGACGACGGGAGCGAACCGGCTGCCTTCTGGGACATGTTTGATAAGGAG
AGCCCGAGGCCGCAGTCGGCGGCGCACTGGAGGCTGAAGCCGAGCTACGACAAGTACCGGAGCCGGCTGTTTTGC
TCGGAGGCCGGTTCGGATGCGCAGATGTACGAAATGCACCCCTTCGTCCAAGCAGACCTCTCCCCCTCACACATC
TACGTCCTCGACGCCTTCTTCGAGCTCTACATCATCATCGGCTCCAAAGCCAACAACCAATACGCCTCCTTCCGT
AACGCCCTCGACTTCGCGCAAGAATACGCCATCCTAGCCGCCGGCATCGAGGACCGACCCTTCGTTCCCGTCTCG
TCCGTCGTGCTCGAGGGCGCGCCCCGTGACCTCAAGCGCGTATTCCGCAAGTGGGATGATAAGAGGAGCCCGACG
GCTGCTGCTGCTGCTGCTCCGATGCCGGCGGCTTCGTCTGGGTCGCTGAGGAGGGGGAGGAGCTTGAAGGTTGTG
ACGCTTACGCAGGCTCTTCAGGCTGTCAGCAGCGATTGA
Gene >Ophcf2|07052
ATGTCCGACGAGGTGTCGCAGTTCCTCGAGCAGGTCGAGCGTCTGCGCGGACAGCAAGCCGGAGAGGACGAGACG
AGAGCCCGTGAGCTGGAGGACTATCTGGCTGCTAAGCGGGAACGCCAGGCCCGCAGAGAAGGTATGTGTAGAGGC
TGCTTGCTGCACAGACCCGTTGACCGACTATCTACTAACCGCGTTGCGCAGAACGCGCTCGATCCATTTCACCCC
AGAAGTCGTCTCCCGTAAACACGCCGTCCCCCCGTTCCAACCGTCGAGCCGGCCAGCAGTCGTCCGATAGGCTCG
AGTCTCCCACCACGCTCGCCGACAAGCAACACCTTGATCTCTCCTCTCTTCCCCTCTCCATGGAACCGCTGGGGT
CGCCGACCAAGGAGAACGAGGCGCCGCTGGACTCGACCGAAGCTAAGCGTGTGTCGACGGCCGACTCCAGATCTT
CCACCCTGTCCTGGCAGAGGAGGCCCAATTCTCGACCCCTGAGCATGGTTGCCGCTCAGAACGCGACGCAGAGGT
CGCTCGCTGGGACTCAGGACTCTTCCACCTTGGACCAGGCAGCTGTCTCTCATGAGCAGATGGCACAGACTCTCG
CCTCCAAAGATCCGTCTCGGTTTCGTCAGACGGACGATCGGGGCATCGGCTCGGCAGACAACCGACGCAGCCAGG
TCGACGACGACGACCGCCTCGACATGACGTCGGCCAAGACGCACCAGCTATCGGGCATGACGATCGAGACGCCCC
GTCGTCCATCGTCCCCGACTCCAGCCAGACTAGGCTCTCCCGTTGCCCTGAAGCCGCATCGACCCGAGCATCTCT
CGATCGACGACAAGCCCTTTATCGAGCCGGGAGTCACCTCGCCGCCCGGCAGGACATCTCCCATCCGCTCGACGT
CTCCCACGAAGGGTGTCGGCGGCTTCGTTCAGAGTGCCATGATGAAGCGAAGCGATAGTGTCAAGCGATGGAGCG
TCACCAGCCCTCCAGGCTTGACCCGTGCCGAGTCCGTTGCTGCCAACCGTAATTCTCACGACCGAACCTCTTCGA
GCATTGGGTCGCGGCCGACGAGCGGTCATTCTCATGCTGGGGCTTCGAGCAGGCCGACATCGAGTCAAGGCGAGG
AAGAGACCGTCGCGCAAACGTCACCGGAACCGCAGAAGAAGTCAGACCGGGCCTCGAAGCCGGACCAGACCTCGA
AACCGGACGACATTGCCGTTCCATCCTCGCCCACCAAGACGATGGATCCGCGCCGCTGGAGCCCGACCAAGTCGA
GCTGGCTTGAGAGCGCTCTCAACAGGCCCGAGTCGCCGACCAAGACGCAGCCGAAACCCAAGGCGCAGCCAGCGT
GGATGGTCGAGCTCAACAAGGCTCGGGCCGAACGCGCAAACAGCCAAGGCATGGACACCTCGCGTAACGTCACGC
ACAAGCATCAGGTCAGCATCGGCGGCCTTATGAGGCAGTCGCCCGTCGGCGAGGTGGCCAAGACGAATCCAACGG
GGCTCGGCGGCATCTACTCTCCGCCTCCTGCGAGCACGACGCCATCCTTCACCACCCGGCCGGTTCTGGGCCATG
AGTCGAAGCCTAGCTTCGCGGAGAGCATCGCCAGCGAGACAGGCGACGTCGATGGCCAGAAGCGACGGCCTTCGG
GCTTTCTGCCCCAGACCAAGCCCAAGCCCGAAGCCGTACAGAACAAAGACTTCCGGGCCGGCCTCCGACAACGGC
CGGCCGGCGCCGACGGCACCAAGAGCGGCGAGCCAGAGTTCAAGAACGTCTTTGGCAACCTGCGCCGGACCAGGA
CTCAAAACTATGTGGCTCCGGACGAGCTCAAGGACAACATTCTCCGGGGAAAGGCCGCGCTCAGCATCACGGATG
GTCCTCGCAAGAACGAGCAGCGGGACGACTTTAAGGAAGCCATCCAGAAGAAGCGCGAAGACTTCAAGAAAGCCC
AAGTCGACGGCAAGGGCGTGACGAGAAGCTCTAGCGGCGACGGTGGGAAGCAGCCGCTCGAGGGTGTGGCCAAGA
GGTTCGAGCTCAAGAGGTCGACAACCGGATCCTCGAATGGATCCAGAAAGGGGAGCCTCGCAGCCGAGAGGAGCC
CCAAGGACGAGGCCCAAGAGTCTTCGTCTTCCTCGGCCAACGCGTCTCCGACGATGGAAACCACGCCTCAGAAGA
ATCAGGCGGCTCCCCCGAGAGTGGCGCCGCCACCATCCGATAAGCCTCTTTCAGAGCAGCCAACGCGACGGGGTT
CGGGCGACATGGAGGCCACGAAGCCGGTGGAGGCCTCATCCACGACGACACGTGCTGGGGCCAAGAAGCTTGCGG
GTCGTCTCAACCCGGCCCTGGCGGGGATGCTGGCTAGAGGACCGCCTCCCATGGCAGCCACCAACGGGGCCGACG
GCTCCGGTGGCCAATCGAGCTCAGCTGCCGGTGACGGGTCGGAGCCGACTGCTGCCGGGCCTCAGCTCACCCACA
TGACCAAGTCTCGGGCACGCGGCCCTAAGAGGAAAGCCCCGACTTCGTCAGCGGCACCATCCCCGAGCATCGGCG
TCGGATCGGATCTAACCAAGGAGCCCAAGGGGCCCATGGAGCAAGTGCCGTCACCCGACCCTGCGGAGAAACCGG
CCGTCCCTCTGTCGATACAGCAGCGGGTGGCGGCCCAGGCAGCGCTTCGCAGCCGCGGCAAGCCGGACAGCGGCA
GCTCATCGGCAGCGGACGAGAGCCCGGCGCCTGTACCTGCTGCTGTGGCGAACAAGACGACGACGGATGGCGGGA
AAGACGCCGGCCTCAAGGTGGACGTGGTGAAAGCATCACGACTCTTTAATGAAACGACGGCGGGAACTGCCCAAC
CCGCGGCATCGTCGATTCACCGGCGTACTGGATCTCGGTCTCCGACAAAGCAGAGCTCAGCGGTCAGGGACGATA
GCCAAGCTTCTCTGCCCAGCACGAGGCCAAAGACGACGCCTGGTGAAAAGGGGGCCGAGCCCAGCCGCAAGGTAG
ATGTGAAGAGGGCATCGCGGATCTTTGACGAAAAGACGGCGGGCACTGCCCAACCCGTAGCGTCGCCTCTTCACC
GGCGCACGGGTTCGCGATCCCCGACCAAGCAGACAATGGCCGATGCCCCCGACGCGGCTCCTAAGAGCAGCGCCT
CGAGACCAACGACGCCGCTGACAAAGTCGACGCTCTCCGCAGAAGCCGTCAAGAGTCCCTCGAGGGCCCCCTCGT
CTCCCGGCAAAGCGACCAACGAGTTGTCGAAGCTGTTGATCGACTTCTTCGGCCCGCCAGTTCCTCGCAAGGAGA
TGCGTGTAGACACGGCGGAACTACTGATGAGCCGACCAACAGGCGGGTCGGGCAAGATTACCAGCCTGGGCTTCC
AGATGTTCCGCATCTTCGGCGACGGTAAGAAAGTGCCGGTTTCGGCGCAGAACGAGCGGGTGCTGTTCGAGCAAG
ACATGTACGTGTGCGCGCACAACTTCACCAACGAGGCCGGTAAGAAGATGTTCGAGATCTACTTCTGGGTGGGCG
ACGAGGTTGGCGAAGCGACGGCTCAAGACGCTCAGTTGTTTGTTCAGCGCGAGGCCAAGTCGCTGGGCGGGACGC
TGGTTCGTCTGAGGCAGGGCAGGGAGACTGCCGAGTTCCTGGCAGCGCTCGGGGGCGTCGTCATGGTGCGTCGTG
GAACGAGCAACAAGTACGACTCGCTGGCGCCCAACATGCTGTGCGGAAGACGCTATCTGGGCCAGGTGGCCTTTG
ACGAGGTCGACTTTGCGCCGTCGAGCCTGTGCTCTGGCTTCACCTACCTCATGGCCCAGGCCGGCAAGTGTTTTC
TCTGGAAGGGCAAGGGCAGCGACGTGGCCGAGATCAGCTGTGCGAGGCTCGTCGGCATCGACCTCAGCCTGACGG
GCGAGCTGATTGAGTGCGACGACGGGAGCGAACCGGCTGCCTTCTGGGACATGTTTGATAAGGAGAGCCCGAGGC
CGCAGTCGGCGGCGCACTGGAGGCTGAAGCCGAGCTACGACAAGTACCGGAGCCGGCTGTTTTGCTCGGAGGCCG
GTTCGGATGCGCAGGTGAGCGAGCAGCCCCCCTTTTCCCGCTTCTCTCCCTCCGTGATTGTATGCTTGTGTGACA
AGACCATCTGTAGAGACAGAGACAGACAAAAGGCTGACAGACACCGACTCACAGATGTACGAAATGCACCCCTTC
GTCCAAGCAGACCTCTCCCCCTCACACATCTACGTCCTCGACGCCTTCTTCGAGCTCTACATCATCATCGGCTCC
AAAGCCAACAACCAATACGCCTCCTTCCGTAACGCCCTCGACTTCGCGCAAGAATACGCCATCCTAGCCGCCGGC
ATCGAGGACCGACCCTTCGTTCCCGTCTCGTCCGTCGTGCTCGAGGGCGCGCCCCGTGACCTCAAGCGCGTATTC
CGCAAGTGGGATGATAAGAGGAGCCCGACGGCTGCTGCTGCTGCTGCTCCGATGCCGGCGGCTTCGTCTGGGTCG
CTGAGGAGGGGGAGGAGCTTGAAGGTTGTGACGCTTACGCAGGCTCTTCAGGCTGTCAGCAGCGATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail