Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|07027
Gene name
Locationscaffold_09:407727..407976
Strand+
Gene length (bp)249
Transcript length (bp)249
Coding sequence length (bp)249
Protein length (aa) 83

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 5 24 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 8.41 0.0 18.54
Alive In ants, during behavior modification 3.88 0.0 9.74
Dead In ants, recently dead 3.71 0.0 9.59

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.247403 no
Alive Dead 0.966401 no
Dead Fungus 0.232272 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|07027
MKTSFVAIVVAFLSSGVLAMPAQAAADVANRDDKPHNKNNDQLKEKSGDGGVAGAVSSLTKGISNVLGGESGSAS
KADSLDN*
Coding >Ophcf2|07027
ATGAAGACCTCTTTCGTCGCCATCGTCGTCGCCTTCCTCAGCAGCGGTGTCCTCGCCATGCCCGCCCAGGCAGCT
GCCGATGTCGCCAACAGGGACGACAAGCCTCACAACAAAAACAATGACCAGCTCAAGGAAAAGTCCGGCGACGGT
GGCGTCGCCGGCGCCGTCTCGTCGTTGACCAAGGGCATTTCGAATGTTCTTGGCGGTGAGAGTGGCAGCGCTAGC
AAGGCTGACTCGCTAGATAATTAA
Transcript >Ophcf2|07027
ATGAAGACCTCTTTCGTCGCCATCGTCGTCGCCTTCCTCAGCAGCGGTGTCCTCGCCATGCCCGCCCAGGCAGCT
GCCGATGTCGCCAACAGGGACGACAAGCCTCACAACAAAAACAATGACCAGCTCAAGGAAAAGTCCGGCGACGGT
GGCGTCGCCGGCGCCGTCTCGTCGTTGACCAAGGGCATTTCGAATGTTCTTGGCGGTGAGAGTGGCAGCGCTAGC
AAGGCTGACTCGCTAGATAATTAA
Gene >Ophcf2|07027
ATGAAGACCTCTTTCGTCGCCATCGTCGTCGCCTTCCTCAGCAGCGGTGTCCTCGCCATGCCCGCCCAGGCAGCT
GCCGATGTCGCCAACAGGGACGACAAGCCTCACAACAAAAACAATGACCAGCTCAAGGAAAAGTCCGGCGACGGT
GGCGTCGCCGGCGCCGTCTCGTCGTTGACCAAGGGCATTTCGAATGTTCTTGGCGGTGAGAGTGGCAGCGCTAGC
AAGGCTGACTCGCTAGATAATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail