Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|07014
Gene name
Locationscaffold_09:355896..356781
Strand-
Gene length (bp)885
Transcript length (bp)885
Coding sequence length (bp)885
Protein length (aa) 295

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6116 0.512 0.284 0.0998 0.326 0.0911 0.1635 0.2582 0.1823 0.0813

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup6496
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|07014 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|223
Ophiocordyceps kimflemingae Ophio5|6689
Ophiocordyceps subramaniannii Hirsu2|106

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|07014
MGHETSKMELSQHATLQNYACSPMSAVSSVSYNVAWTEWSKTPILVGSFYPYNERSWATFLSETLPSDLMDDFAA
AWNVSRSKLIERLDRNYRVNPISFTDVMLDLFDYSSYSGPVCWPKAHLGSLVTGYHSTLGSLANLVVPEQSLYGT
WSVKTFPGAPKTEFRDGETYCISPRDPYYNEVGAAITHEMCQWTSFKTWKAERNMQDADDIFMSYSHPFIKAFAR
SFKKAYSCSAIQGCLPWVFRGEAWVPPDMWRMQEKVVQLFRMRSHFCIMLGIGEPPDGFITLNTYSKVR*
Coding >Ophcf2|07014
ATGGGCCACGAAACCTCAAAGATGGAACTCTCCCAGCACGCAACCCTGCAAAACTACGCCTGCAGCCCCATGTCC
GCCGTCAGCTCGGTGTCCTATAACGTGGCCTGGACCGAGTGGAGCAAAACTCCCATCCTCGTCGGCTCCTTCTAC
CCTTACAATGAGAGGAGCTGGGCGACGTTTCTGTCCGAGACGCTGCCTTCGGATCTGATGGATGACTTTGCCGCC
GCCTGGAACGTCAGTCGCAGCAAGCTCATAGAGAGACTCGATCGAAACTACAGAGTCAATCCAATCTCCTTCACC
GACGTCATGCTGGATCTATTTGACTACAGCAGCTACTCTGGCCCAGTGTGCTGGCCCAAAGCCCATCTCGGATCC
CTCGTGACCGGATATCACTCCACGCTGGGCTCGCTGGCCAACCTGGTGGTGCCAGAACAGTCCCTCTACGGCACA
TGGTCCGTCAAGACCTTCCCCGGCGCACCCAAAACCGAGTTCCGCGATGGCGAGACATACTGCATTTCCCCACGA
GACCCTTACTACAACGAAGTCGGCGCCGCCATCACGCACGAAATGTGCCAGTGGACCTCGTTCAAAACCTGGAAA
GCGGAAAGGAACATGCAAGACGCAGACGACATCTTCATGTCCTACAGCCACCCCTTCATAAAGGCATTCGCCAGG
AGCTTCAAGAAGGCCTACTCGTGCTCGGCGATTCAGGGATGTCTGCCATGGGTGTTTAGGGGCGAGGCCTGGGTT
CCGCCTGATATGTGGAGGATGCAGGAAAAGGTAGTTCAGCTGTTTAGGATGCGATCTCATTTCTGCATCATGTTG
GGGATAGGTGAGCCGCCTGATGGGTTCATTACTTTAAATACGTATTCCAAGGTGAGGTAG
Transcript >Ophcf2|07014
ATGGGCCACGAAACCTCAAAGATGGAACTCTCCCAGCACGCAACCCTGCAAAACTACGCCTGCAGCCCCATGTCC
GCCGTCAGCTCGGTGTCCTATAACGTGGCCTGGACCGAGTGGAGCAAAACTCCCATCCTCGTCGGCTCCTTCTAC
CCTTACAATGAGAGGAGCTGGGCGACGTTTCTGTCCGAGACGCTGCCTTCGGATCTGATGGATGACTTTGCCGCC
GCCTGGAACGTCAGTCGCAGCAAGCTCATAGAGAGACTCGATCGAAACTACAGAGTCAATCCAATCTCCTTCACC
GACGTCATGCTGGATCTATTTGACTACAGCAGCTACTCTGGCCCAGTGTGCTGGCCCAAAGCCCATCTCGGATCC
CTCGTGACCGGATATCACTCCACGCTGGGCTCGCTGGCCAACCTGGTGGTGCCAGAACAGTCCCTCTACGGCACA
TGGTCCGTCAAGACCTTCCCCGGCGCACCCAAAACCGAGTTCCGCGATGGCGAGACATACTGCATTTCCCCACGA
GACCCTTACTACAACGAAGTCGGCGCCGCCATCACGCACGAAATGTGCCAGTGGACCTCGTTCAAAACCTGGAAA
GCGGAAAGGAACATGCAAGACGCAGACGACATCTTCATGTCCTACAGCCACCCCTTCATAAAGGCATTCGCCAGG
AGCTTCAAGAAGGCCTACTCGTGCTCGGCGATTCAGGGATGTCTGCCATGGGTGTTTAGGGGCGAGGCCTGGGTT
CCGCCTGATATGTGGAGGATGCAGGAAAAGGTAGTTCAGCTGTTTAGGATGCGATCTCATTTCTGCATCATGTTG
GGGATAGGTGAGCCGCCTGATGGGTTCATTACTTTAAATACGTATTCCAAGGTGAGGTAG
Gene >Ophcf2|07014
ATGGGCCACGAAACCTCAAAGATGGAACTCTCCCAGCACGCAACCCTGCAAAACTACGCCTGCAGCCCCATGTCC
GCCGTCAGCTCGGTGTCCTATAACGTGGCCTGGACCGAGTGGAGCAAAACTCCCATCCTCGTCGGCTCCTTCTAC
CCTTACAATGAGAGGAGCTGGGCGACGTTTCTGTCCGAGACGCTGCCTTCGGATCTGATGGATGACTTTGCCGCC
GCCTGGAACGTCAGTCGCAGCAAGCTCATAGAGAGACTCGATCGAAACTACAGAGTCAATCCAATCTCCTTCACC
GACGTCATGCTGGATCTATTTGACTACAGCAGCTACTCTGGCCCAGTGTGCTGGCCCAAAGCCCATCTCGGATCC
CTCGTGACCGGATATCACTCCACGCTGGGCTCGCTGGCCAACCTGGTGGTGCCAGAACAGTCCCTCTACGGCACA
TGGTCCGTCAAGACCTTCCCCGGCGCACCCAAAACCGAGTTCCGCGATGGCGAGACATACTGCATTTCCCCACGA
GACCCTTACTACAACGAAGTCGGCGCCGCCATCACGCACGAAATGTGCCAGTGGACCTCGTTCAAAACCTGGAAA
GCGGAAAGGAACATGCAAGACGCAGACGACATCTTCATGTCCTACAGCCACCCCTTCATAAAGGCATTCGCCAGG
AGCTTCAAGAAGGCCTACTCGTGCTCGGCGATTCAGGGATGTCTGCCATGGGTGTTTAGGGGCGAGGCCTGGGTT
CCGCCTGATATGTGGAGGATGCAGGAAAAGGTAGTTCAGCTGTTTAGGATGCGATCTCATTTCTGCATCATGTTG
GGGATAGGTGAGCCGCCTGATGGGTTCATTACTTTAAATACGTATTCCAAGGTGAGGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail