Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|07013
Gene name
Locationscaffold_09:354034..355249
Strand-
Gene length (bp)1215
Transcript length (bp)1215
Coding sequence length (bp)1215
Protein length (aa) 405

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.1E-25 18 357
PF00083 Sugar_tr Sugar (and other) transporter 8.9E-09 15 126

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0016021 integral component of membrane Yes
GO:0005575 cellular_component No
GO:0051179 localization No
GO:0008150 biological_process No
GO:0031224 intrinsic component of membrane No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0110165 cellular anatomical entity No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.5

Transmembrane Domains

Domain # Start End Length
1 13 35 22
2 47 66 19
3 71 93 22
4 106 128 22
5 148 170 22
6 203 225 22
7 240 262 22
8 271 293 22
9 303 325 22
10 338 360 22
11 375 397 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 32.45 16.70 48.21
Alive In ants, during behavior modification 135.41 68.21 202.60
Dead In ants, recently dead 88.61 50.19 127.04

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.015153 yes
Dead Fungus 0.000238 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|07013
MVQQNGHLADSDVGFYSGLIESCFSLSQMMFLIAWSRLADRIGRKPVLIGTLSGMAIGQALFGLSTSLSAMIAFR
SLSGILSGSGVIVRTAIGDVSTVETRAAAYSWFGFAGNLGMFLGPLVGGALADPARTMPRYFGQVHLLIRHPYAL
SGLAVAVIIGGSALAAAVGLRETLPEKKLRGHHEEPALSVRQLIARRGVAAGLAIYVHVMLLAFVFAAILPLALY
TPIHLGGMACSSAATSVYLAVQGASQALWLILVFPWLQGRIGTKRVLRLCGFAGPLFYGGFVLMNALLRLESDVS
HRLFWAVGVVVATVGPGVNMAATCAQLIIQEVAPDDRSVGLINALALTLASAIRSFVPAVSTIVFAFGVRSQILF
GYLAWAVLIPLSAALIVMPSLLPDETEAN*
Coding >Ophcf2|07013
ATGGTGCAACAAAACGGCCACCTCGCAGACTCGGACGTCGGATTCTACAGCGGCCTGATAGAAAGCTGCTTCTCC
CTATCACAAATGATGTTCCTAATCGCCTGGTCCAGACTGGCGGATCGTATAGGCCGCAAGCCCGTCCTCATCGGC
ACCCTCTCCGGCATGGCCATCGGACAAGCCCTCTTCGGACTATCCACAAGTCTGTCGGCCATGATAGCCTTCCGC
TCTTTATCGGGGATCCTCTCCGGCTCGGGCGTCATCGTCCGGACCGCCATCGGAGATGTCAGCACGGTCGAGACG
CGAGCAGCGGCTTACAGCTGGTTCGGCTTCGCCGGGAATCTCGGCATGTTCCTCGGCCCTCTCGTCGGCGGCGCG
CTCGCAGATCCGGCCCGGACGATGCCGCGATACTTCGGACAAGTCCATCTGCTGATCCGGCATCCATACGCTTTA
TCCGGCCTGGCCGTAGCCGTCATCATCGGAGGTTCCGCCCTCGCCGCCGCCGTCGGTCTCCGCGAGACGCTCCCG
GAGAAGAAGCTCAGGGGCCACCACGAGGAGCCAGCCCTATCAGTCCGTCAACTCATCGCCCGTCGAGGCGTAGCA
GCAGGATTGGCCATCTACGTGCACGTCATGCTGCTGGCCTTTGTCTTCGCCGCCATCCTCCCGTTGGCCCTGTAC
ACGCCCATCCATCTAGGGGGGATGGCCTGCTCTTCAGCGGCCACATCCGTCTACCTGGCCGTCCAGGGAGCCAGC
CAGGCGCTGTGGCTGATCCTCGTCTTCCCCTGGCTTCAGGGGCGCATCGGCACCAAGCGTGTCCTCCGTCTCTGT
GGCTTCGCTGGCCCTCTGTTCTACGGCGGCTTCGTCCTCATGAACGCCCTGCTTCGACTCGAAAGCGACGTCTCC
CACCGTCTCTTCTGGGCCGTCGGCGTTGTCGTAGCGACCGTTGGACCTGGAGTCAACATGGCCGCGACTTGTGCT
CAGCTCATCATCCAGGAGGTGGCCCCTGATGACCGTTCTGTTGGGCTCATAAACGCACTGGCTTTGACGCTGGCC
AGCGCCATCCGCTCCTTTGTTCCGGCGGTATCGACCATCGTCTTTGCTTTTGGCGTTCGCTCCCAGATCTTATTC
GGCTATCTGGCCTGGGCGGTGCTGATTCCGCTATCGGCTGCGCTGATCGTCATGCCATCGTTGCTGCCAGACGAG
ACGGAAGCTAATTGA
Transcript >Ophcf2|07013
ATGGTGCAACAAAACGGCCACCTCGCAGACTCGGACGTCGGATTCTACAGCGGCCTGATAGAAAGCTGCTTCTCC
CTATCACAAATGATGTTCCTAATCGCCTGGTCCAGACTGGCGGATCGTATAGGCCGCAAGCCCGTCCTCATCGGC
ACCCTCTCCGGCATGGCCATCGGACAAGCCCTCTTCGGACTATCCACAAGTCTGTCGGCCATGATAGCCTTCCGC
TCTTTATCGGGGATCCTCTCCGGCTCGGGCGTCATCGTCCGGACCGCCATCGGAGATGTCAGCACGGTCGAGACG
CGAGCAGCGGCTTACAGCTGGTTCGGCTTCGCCGGGAATCTCGGCATGTTCCTCGGCCCTCTCGTCGGCGGCGCG
CTCGCAGATCCGGCCCGGACGATGCCGCGATACTTCGGACAAGTCCATCTGCTGATCCGGCATCCATACGCTTTA
TCCGGCCTGGCCGTAGCCGTCATCATCGGAGGTTCCGCCCTCGCCGCCGCCGTCGGTCTCCGCGAGACGCTCCCG
GAGAAGAAGCTCAGGGGCCACCACGAGGAGCCAGCCCTATCAGTCCGTCAACTCATCGCCCGTCGAGGCGTAGCA
GCAGGATTGGCCATCTACGTGCACGTCATGCTGCTGGCCTTTGTCTTCGCCGCCATCCTCCCGTTGGCCCTGTAC
ACGCCCATCCATCTAGGGGGGATGGCCTGCTCTTCAGCGGCCACATCCGTCTACCTGGCCGTCCAGGGAGCCAGC
CAGGCGCTGTGGCTGATCCTCGTCTTCCCCTGGCTTCAGGGGCGCATCGGCACCAAGCGTGTCCTCCGTCTCTGT
GGCTTCGCTGGCCCTCTGTTCTACGGCGGCTTCGTCCTCATGAACGCCCTGCTTCGACTCGAAAGCGACGTCTCC
CACCGTCTCTTCTGGGCCGTCGGCGTTGTCGTAGCGACCGTTGGACCTGGAGTCAACATGGCCGCGACTTGTGCT
CAGCTCATCATCCAGGAGGTGGCCCCTGATGACCGTTCTGTTGGGCTCATAAACGCACTGGCTTTGACGCTGGCC
AGCGCCATCCGCTCCTTTGTTCCGGCGGTATCGACCATCGTCTTTGCTTTTGGCGTTCGCTCCCAGATCTTATTC
GGCTATCTGGCCTGGGCGGTGCTGATTCCGCTATCGGCTGCGCTGATCGTCATGCCATCGTTGCTGCCAGACGAG
ACGGAAGCTAATTGA
Gene >Ophcf2|07013
ATGGTGCAACAAAACGGCCACCTCGCAGACTCGGACGTCGGATTCTACAGCGGCCTGATAGAAAGCTGCTTCTCC
CTATCACAAATGATGTTCCTAATCGCCTGGTCCAGACTGGCGGATCGTATAGGCCGCAAGCCCGTCCTCATCGGC
ACCCTCTCCGGCATGGCCATCGGACAAGCCCTCTTCGGACTATCCACAAGTCTGTCGGCCATGATAGCCTTCCGC
TCTTTATCGGGGATCCTCTCCGGCTCGGGCGTCATCGTCCGGACCGCCATCGGAGATGTCAGCACGGTCGAGACG
CGAGCAGCGGCTTACAGCTGGTTCGGCTTCGCCGGGAATCTCGGCATGTTCCTCGGCCCTCTCGTCGGCGGCGCG
CTCGCAGATCCGGCCCGGACGATGCCGCGATACTTCGGACAAGTCCATCTGCTGATCCGGCATCCATACGCTTTA
TCCGGCCTGGCCGTAGCCGTCATCATCGGAGGTTCCGCCCTCGCCGCCGCCGTCGGTCTCCGCGAGACGCTCCCG
GAGAAGAAGCTCAGGGGCCACCACGAGGAGCCAGCCCTATCAGTCCGTCAACTCATCGCCCGTCGAGGCGTAGCA
GCAGGATTGGCCATCTACGTGCACGTCATGCTGCTGGCCTTTGTCTTCGCCGCCATCCTCCCGTTGGCCCTGTAC
ACGCCCATCCATCTAGGGGGGATGGCCTGCTCTTCAGCGGCCACATCCGTCTACCTGGCCGTCCAGGGAGCCAGC
CAGGCGCTGTGGCTGATCCTCGTCTTCCCCTGGCTTCAGGGGCGCATCGGCACCAAGCGTGTCCTCCGTCTCTGT
GGCTTCGCTGGCCCTCTGTTCTACGGCGGCTTCGTCCTCATGAACGCCCTGCTTCGACTCGAAAGCGACGTCTCC
CACCGTCTCTTCTGGGCCGTCGGCGTTGTCGTAGCGACCGTTGGACCTGGAGTCAACATGGCCGCGACTTGTGCT
CAGCTCATCATCCAGGAGGTGGCCCCTGATGACCGTTCTGTTGGGCTCATAAACGCACTGGCTTTGACGCTGGCC
AGCGCCATCCGCTCCTTTGTTCCGGCGGTATCGACCATCGTCTTTGCTTTTGGCGTTCGCTCCCAGATCTTATTC
GGCTATCTGGCCTGGGCGGTGCTGATTCCGCTATCGGCTGCGCTGATCGTCATGCCATCGTTGCTGCCAGACGAG
ACGGAAGCTAATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail