Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|07012
Gene name
Locationscaffold_09:352372..353902
Strand+
Gene length (bp)1530
Transcript length (bp)1530
Coding sequence length (bp)1530
Protein length (aa) 510

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01062 Bestrophin Bestrophin, RFP-TM, chloride channel 3.8E-41 60 388

GO

GO Term Description Terminal node
GO:0005254 chloride channel activity Yes
GO:0022803 passive transmembrane transporter activity No
GO:0008509 anion transmembrane transporter activity No
GO:0005216 ion channel activity No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0022857 transmembrane transporter activity No
GO:0015075 ion transmembrane transporter activity No
GO:0005253 anion channel activity No
GO:0015103 inorganic anion transmembrane transporter activity No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0015267 channel activity No
GO:0015108 chloride transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 47 0.45

Transmembrane Domains

Domain # Start End Length
1 62 84 22
2 99 118 19
3 313 335 22
4 345 367 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 53.28 30.13 76.43
Alive In ants, during behavior modification 190.33 86.53 294.13
Dead In ants, recently dead 167.89 87.81 247.97

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.564841 no
Dead Fungus 0.000238 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|07012
MDDGGRLQSPRSPVSASSPPTSPPTGPGPGPEPSARHHGSGLDLNDYFTGPRDMARHSRWPLLLRLHGSILPKLI
LPVVLISIWSATITIVSIKVHPLGVHSVLLTLTGFVVSLSLSFRCSTAYERYSEGRKYWTGLVQASHVLGRVFWI
HAKDGPDMDPREGLLLRLTSMNLVVAFALSLKHGLRFEPYLYPDMATLVDHLNTWASAATTMTTTTTTTTTTDDP
SGSRLRRRRFFHSVGEYLGLSFTASNPRKALKRATQPLGHLPLEILGHLAIAIDALVADQQLTVPAHQTLAYNAL
QSLNDVMTGTERVLCTPLPIAYSIAISQATYLYLALLPFQLIPLLHWIAIPATIAASCIILSLLFIGQEIEDPFG
HDVNDLPLDSYCDQIAADLDIIASIDTREPRAFLTSRRNRPLHPVSTAPYDIWLQRDEQRLREAVRQKPAARFEG
ARWGKNNGSKVSAGSGSLASNNNNNNNNNNNNNNSGSSSGSSRISSSSSSRISSSEKQG*
Coding >Ophcf2|07012
ATGGACGACGGCGGCCGGCTCCAGTCGCCCCGCAGCCCCGTCTCGGCCTCTTCTCCGCCGACGTCTCCGCCGACC
GGCCCCGGCCCCGGCCCCGAACCGTCTGCCCGTCATCATGGCTCGGGCCTCGATCTCAATGACTACTTCACCGGT
CCGCGCGATATGGCGCGTCACAGCCGCTGGCCGCTCTTGCTGCGGCTTCACGGCAGCATCCTCCCAAAGCTGATC
TTGCCAGTCGTTCTCATCAGCATCTGGAGCGCCACCATCACCATCGTGTCCATAAAGGTGCACCCGCTAGGCGTA
CACTCGGTGCTGCTGACGCTTACGGGCTTCGTCGTCTCGCTGTCGCTGTCGTTTCGATGCTCGACTGCTTACGAG
CGCTACTCGGAGGGTCGCAAGTACTGGACAGGTCTCGTCCAGGCCTCGCACGTTCTTGGTCGAGTCTTCTGGATT
CATGCCAAGGACGGACCGGATATGGATCCTCGCGAGGGCTTGTTGCTGCGGCTGACGTCGATGAACCTGGTCGTT
GCCTTTGCTCTCTCGCTCAAACATGGCCTGCGCTTCGAGCCCTACCTCTATCCAGACATGGCCACCCTTGTCGAC
CATCTCAATACGTGGGCGTCTGCGGCGACGACGATGACGACGACGACGACGACGACGACGACAACTGATGATCCG
TCTGGTTCCCGTCTTCGTCGCCGTCGCTTCTTCCATAGCGTGGGCGAGTATCTCGGCCTCTCCTTTACAGCCAGC
AACCCGCGAAAGGCGCTCAAACGAGCCACCCAGCCGCTGGGCCACCTCCCGCTCGAGATTCTCGGTCATCTGGCC
ATCGCCATCGACGCCCTCGTCGCCGACCAGCAGTTGACGGTGCCGGCGCACCAGACGTTGGCCTACAACGCCTTA
CAGTCGCTCAACGACGTCATGACGGGCACCGAACGGGTTCTCTGCACGCCCCTGCCCATCGCCTACTCCATCGCC
ATCTCCCAGGCCACTTACCTGTATCTGGCCCTGCTGCCCTTTCAGCTGATCCCGCTGCTGCACTGGATCGCCATC
CCCGCCACCATTGCCGCCTCGTGCATCATCCTCAGCCTGCTCTTCATCGGCCAGGAGATTGAGGACCCCTTTGGC
CACGACGTCAACGACCTGCCTCTCGACAGCTACTGCGACCAGATCGCCGCCGACCTCGATATCATCGCCTCTATT
GACACGCGTGAGCCTCGCGCCTTTCTCACCAGCCGCCGCAACCGACCGCTGCACCCAGTCAGCACGGCGCCTTAT
GATATCTGGCTTCAGCGAGACGAGCAGAGGCTTCGAGAGGCGGTCCGGCAGAAGCCTGCTGCCCGGTTCGAAGGC
GCGAGATGGGGAAAGAATAACGGAAGCAAGGTCAGCGCGGGCTCTGGTAGCCTTGCGAGCAACAACAACAACAAC
AACAACAACAACAACAACAACAACAACAGCGGCAGCAGCAGCGGCAGCAGCAGAATCAGCAGCAGCAGCAGCAGC
AGAATCAGCAGCAGCGAGAAGCAGGGCTGA
Transcript >Ophcf2|07012
ATGGACGACGGCGGCCGGCTCCAGTCGCCCCGCAGCCCCGTCTCGGCCTCTTCTCCGCCGACGTCTCCGCCGACC
GGCCCCGGCCCCGGCCCCGAACCGTCTGCCCGTCATCATGGCTCGGGCCTCGATCTCAATGACTACTTCACCGGT
CCGCGCGATATGGCGCGTCACAGCCGCTGGCCGCTCTTGCTGCGGCTTCACGGCAGCATCCTCCCAAAGCTGATC
TTGCCAGTCGTTCTCATCAGCATCTGGAGCGCCACCATCACCATCGTGTCCATAAAGGTGCACCCGCTAGGCGTA
CACTCGGTGCTGCTGACGCTTACGGGCTTCGTCGTCTCGCTGTCGCTGTCGTTTCGATGCTCGACTGCTTACGAG
CGCTACTCGGAGGGTCGCAAGTACTGGACAGGTCTCGTCCAGGCCTCGCACGTTCTTGGTCGAGTCTTCTGGATT
CATGCCAAGGACGGACCGGATATGGATCCTCGCGAGGGCTTGTTGCTGCGGCTGACGTCGATGAACCTGGTCGTT
GCCTTTGCTCTCTCGCTCAAACATGGCCTGCGCTTCGAGCCCTACCTCTATCCAGACATGGCCACCCTTGTCGAC
CATCTCAATACGTGGGCGTCTGCGGCGACGACGATGACGACGACGACGACGACGACGACGACAACTGATGATCCG
TCTGGTTCCCGTCTTCGTCGCCGTCGCTTCTTCCATAGCGTGGGCGAGTATCTCGGCCTCTCCTTTACAGCCAGC
AACCCGCGAAAGGCGCTCAAACGAGCCACCCAGCCGCTGGGCCACCTCCCGCTCGAGATTCTCGGTCATCTGGCC
ATCGCCATCGACGCCCTCGTCGCCGACCAGCAGTTGACGGTGCCGGCGCACCAGACGTTGGCCTACAACGCCTTA
CAGTCGCTCAACGACGTCATGACGGGCACCGAACGGGTTCTCTGCACGCCCCTGCCCATCGCCTACTCCATCGCC
ATCTCCCAGGCCACTTACCTGTATCTGGCCCTGCTGCCCTTTCAGCTGATCCCGCTGCTGCACTGGATCGCCATC
CCCGCCACCATTGCCGCCTCGTGCATCATCCTCAGCCTGCTCTTCATCGGCCAGGAGATTGAGGACCCCTTTGGC
CACGACGTCAACGACCTGCCTCTCGACAGCTACTGCGACCAGATCGCCGCCGACCTCGATATCATCGCCTCTATT
GACACGCGTGAGCCTCGCGCCTTTCTCACCAGCCGCCGCAACCGACCGCTGCACCCAGTCAGCACGGCGCCTTAT
GATATCTGGCTTCAGCGAGACGAGCAGAGGCTTCGAGAGGCGGTCCGGCAGAAGCCTGCTGCCCGGTTCGAAGGC
GCGAGATGGGGAAAGAATAACGGAAGCAAGGTCAGCGCGGGCTCTGGTAGCCTTGCGAGCAACAACAACAACAAC
AACAACAACAACAACAACAACAACAACAGCGGCAGCAGCAGCGGCAGCAGCAGAATCAGCAGCAGCAGCAGCAGC
AGAATCAGCAGCAGCGAGAAGCAGGGCTGA
Gene >Ophcf2|07012
ATGGACGACGGCGGCCGGCTCCAGTCGCCCCGCAGCCCCGTCTCGGCCTCTTCTCCGCCGACGTCTCCGCCGACC
GGCCCCGGCCCCGGCCCCGAACCGTCTGCCCGTCATCATGGCTCGGGCCTCGATCTCAATGACTACTTCACCGGT
CCGCGCGATATGGCGCGTCACAGCCGCTGGCCGCTCTTGCTGCGGCTTCACGGCAGCATCCTCCCAAAGCTGATC
TTGCCAGTCGTTCTCATCAGCATCTGGAGCGCCACCATCACCATCGTGTCCATAAAGGTGCACCCGCTAGGCGTA
CACTCGGTGCTGCTGACGCTTACGGGCTTCGTCGTCTCGCTGTCGCTGTCGTTTCGATGCTCGACTGCTTACGAG
CGCTACTCGGAGGGTCGCAAGTACTGGACAGGTCTCGTCCAGGCCTCGCACGTTCTTGGTCGAGTCTTCTGGATT
CATGCCAAGGACGGACCGGATATGGATCCTCGCGAGGGCTTGTTGCTGCGGCTGACGTCGATGAACCTGGTCGTT
GCCTTTGCTCTCTCGCTCAAACATGGCCTGCGCTTCGAGCCCTACCTCTATCCAGACATGGCCACCCTTGTCGAC
CATCTCAATACGTGGGCGTCTGCGGCGACGACGATGACGACGACGACGACGACGACGACGACAACTGATGATCCG
TCTGGTTCCCGTCTTCGTCGCCGTCGCTTCTTCCATAGCGTGGGCGAGTATCTCGGCCTCTCCTTTACAGCCAGC
AACCCGCGAAAGGCGCTCAAACGAGCCACCCAGCCGCTGGGCCACCTCCCGCTCGAGATTCTCGGTCATCTGGCC
ATCGCCATCGACGCCCTCGTCGCCGACCAGCAGTTGACGGTGCCGGCGCACCAGACGTTGGCCTACAACGCCTTA
CAGTCGCTCAACGACGTCATGACGGGCACCGAACGGGTTCTCTGCACGCCCCTGCCCATCGCCTACTCCATCGCC
ATCTCCCAGGCCACTTACCTGTATCTGGCCCTGCTGCCCTTTCAGCTGATCCCGCTGCTGCACTGGATCGCCATC
CCCGCCACCATTGCCGCCTCGTGCATCATCCTCAGCCTGCTCTTCATCGGCCAGGAGATTGAGGACCCCTTTGGC
CACGACGTCAACGACCTGCCTCTCGACAGCTACTGCGACCAGATCGCCGCCGACCTCGATATCATCGCCTCTATT
GACACGCGTGAGCCTCGCGCCTTTCTCACCAGCCGCCGCAACCGACCGCTGCACCCAGTCAGCACGGCGCCTTAT
GATATCTGGCTTCAGCGAGACGAGCAGAGGCTTCGAGAGGCGGTCCGGCAGAAGCCTGCTGCCCGGTTCGAAGGC
GCGAGATGGGGAAAGAATAACGGAAGCAAGGTCAGCGCGGGCTCTGGTAGCCTTGCGAGCAACAACAACAACAAC
AACAACAACAACAACAACAACAACAACAGCGGCAGCAGCAGCGGCAGCAGCAGAATCAGCAGCAGCAGCAGCAGC
AGAATCAGCAGCAGCGAGAAGCAGGGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail