Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|07012
Gene name
Locationscaffold_09:352372..353902
Strand+
Gene length (bp)1530
Transcript length (bp)1530
Coding sequence length (bp)1530
Protein length (aa) 510

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01062 Bestrophin Bestrophin, RFP-TM, chloride channel 3.8E-41 60 388

GO

GO Term Description Terminal node
GO:0005254 chloride channel activity Yes
GO:0022803 passive transmembrane transporter activity No
GO:0008509 anion transmembrane transporter activity No
GO:0005216 ion channel activity No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0022857 transmembrane transporter activity No
GO:0015075 ion transmembrane transporter activity No
GO:0005253 anion channel activity No
GO:0015103 inorganic anion transmembrane transporter activity No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0015267 channel activity No
GO:0015108 chloride transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 47 0.45

Transmembrane Domains

Domain # Start End Length
1 62 84 22
2 99 118 19
3 313 335 22
4 345 367 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|07012
MDDGGRLQSPRSPVSASSPPTSPPTGPGPGPEPSARHHGSGLDLNDYFTGPRDMARHSRWPLLLRLHGSILPKLI
LPVVLISIWSATITIVSIKVHPLGVHSVLLTLTGFVVSLSLSFRCSTAYERYSEGRKYWTGLVQASHVLGRVFWI
HAKDGPDMDPREGLLLRLTSMNLVVAFALSLKHGLRFEPYLYPDMATLVDHLNTWASAATTMTTTTTTTTTTDDP
SGSRLRRRRFFHSVGEYLGLSFTASNPRKALKRATQPLGHLPLEILGHLAIAIDALVADQQLTVPAHQTLAYNAL
QSLNDVMTGTERVLCTPLPIAYSIAISQATYLYLALLPFQLIPLLHWIAIPATIAASCIILSLLFIGQEIEDPFG
HDVNDLPLDSYCDQIAADLDIIASIDTREPRAFLTSRRNRPLHPVSTAPYDIWLQRDEQRLREAVRQKPAARFEG
ARWGKNNGSKVSAGSGSLASNNNNNNNNNNNNNNSGSSSGSSRISSSSSSRISSSEKQG*
Coding >Ophcf2|07012
ATGGACGACGGCGGCCGGCTCCAGTCGCCCCGCAGCCCCGTCTCGGCCTCTTCTCCGCCGACGTCTCCGCCGACC
GGCCCCGGCCCCGGCCCCGAACCGTCTGCCCGTCATCATGGCTCGGGCCTCGATCTCAATGACTACTTCACCGGT
CCGCGCGATATGGCGCGTCACAGCCGCTGGCCGCTCTTGCTGCGGCTTCACGGCAGCATCCTCCCAAAGCTGATC
TTGCCAGTCGTTCTCATCAGCATCTGGAGCGCCACCATCACCATCGTGTCCATAAAGGTGCACCCGCTAGGCGTA
CACTCGGTGCTGCTGACGCTTACGGGCTTCGTCGTCTCGCTGTCGCTGTCGTTTCGATGCTCGACTGCTTACGAG
CGCTACTCGGAGGGTCGCAAGTACTGGACAGGTCTCGTCCAGGCCTCGCACGTTCTTGGTCGAGTCTTCTGGATT
CATGCCAAGGACGGACCGGATATGGATCCTCGCGAGGGCTTGTTGCTGCGGCTGACGTCGATGAACCTGGTCGTT
GCCTTTGCTCTCTCGCTCAAACATGGCCTGCGCTTCGAGCCCTACCTCTATCCAGACATGGCCACCCTTGTCGAC
CATCTCAATACGTGGGCGTCTGCGGCGACGACGATGACGACGACGACGACGACGACGACGACAACTGATGATCCG
TCTGGTTCCCGTCTTCGTCGCCGTCGCTTCTTCCATAGCGTGGGCGAGTATCTCGGCCTCTCCTTTACAGCCAGC
AACCCGCGAAAGGCGCTCAAACGAGCCACCCAGCCGCTGGGCCACCTCCCGCTCGAGATTCTCGGTCATCTGGCC
ATCGCCATCGACGCCCTCGTCGCCGACCAGCAGTTGACGGTGCCGGCGCACCAGACGTTGGCCTACAACGCCTTA
CAGTCGCTCAACGACGTCATGACGGGCACCGAACGGGTTCTCTGCACGCCCCTGCCCATCGCCTACTCCATCGCC
ATCTCCCAGGCCACTTACCTGTATCTGGCCCTGCTGCCCTTTCAGCTGATCCCGCTGCTGCACTGGATCGCCATC
CCCGCCACCATTGCCGCCTCGTGCATCATCCTCAGCCTGCTCTTCATCGGCCAGGAGATTGAGGACCCCTTTGGC
CACGACGTCAACGACCTGCCTCTCGACAGCTACTGCGACCAGATCGCCGCCGACCTCGATATCATCGCCTCTATT
GACACGCGTGAGCCTCGCGCCTTTCTCACCAGCCGCCGCAACCGACCGCTGCACCCAGTCAGCACGGCGCCTTAT
GATATCTGGCTTCAGCGAGACGAGCAGAGGCTTCGAGAGGCGGTCCGGCAGAAGCCTGCTGCCCGGTTCGAAGGC
GCGAGATGGGGAAAGAATAACGGAAGCAAGGTCAGCGCGGGCTCTGGTAGCCTTGCGAGCAACAACAACAACAAC
AACAACAACAACAACAACAACAACAACAGCGGCAGCAGCAGCGGCAGCAGCAGAATCAGCAGCAGCAGCAGCAGC
AGAATCAGCAGCAGCGAGAAGCAGGGCTGA
Transcript >Ophcf2|07012
ATGGACGACGGCGGCCGGCTCCAGTCGCCCCGCAGCCCCGTCTCGGCCTCTTCTCCGCCGACGTCTCCGCCGACC
GGCCCCGGCCCCGGCCCCGAACCGTCTGCCCGTCATCATGGCTCGGGCCTCGATCTCAATGACTACTTCACCGGT
CCGCGCGATATGGCGCGTCACAGCCGCTGGCCGCTCTTGCTGCGGCTTCACGGCAGCATCCTCCCAAAGCTGATC
TTGCCAGTCGTTCTCATCAGCATCTGGAGCGCCACCATCACCATCGTGTCCATAAAGGTGCACCCGCTAGGCGTA
CACTCGGTGCTGCTGACGCTTACGGGCTTCGTCGTCTCGCTGTCGCTGTCGTTTCGATGCTCGACTGCTTACGAG
CGCTACTCGGAGGGTCGCAAGTACTGGACAGGTCTCGTCCAGGCCTCGCACGTTCTTGGTCGAGTCTTCTGGATT
CATGCCAAGGACGGACCGGATATGGATCCTCGCGAGGGCTTGTTGCTGCGGCTGACGTCGATGAACCTGGTCGTT
GCCTTTGCTCTCTCGCTCAAACATGGCCTGCGCTTCGAGCCCTACCTCTATCCAGACATGGCCACCCTTGTCGAC
CATCTCAATACGTGGGCGTCTGCGGCGACGACGATGACGACGACGACGACGACGACGACGACAACTGATGATCCG
TCTGGTTCCCGTCTTCGTCGCCGTCGCTTCTTCCATAGCGTGGGCGAGTATCTCGGCCTCTCCTTTACAGCCAGC
AACCCGCGAAAGGCGCTCAAACGAGCCACCCAGCCGCTGGGCCACCTCCCGCTCGAGATTCTCGGTCATCTGGCC
ATCGCCATCGACGCCCTCGTCGCCGACCAGCAGTTGACGGTGCCGGCGCACCAGACGTTGGCCTACAACGCCTTA
CAGTCGCTCAACGACGTCATGACGGGCACCGAACGGGTTCTCTGCACGCCCCTGCCCATCGCCTACTCCATCGCC
ATCTCCCAGGCCACTTACCTGTATCTGGCCCTGCTGCCCTTTCAGCTGATCCCGCTGCTGCACTGGATCGCCATC
CCCGCCACCATTGCCGCCTCGTGCATCATCCTCAGCCTGCTCTTCATCGGCCAGGAGATTGAGGACCCCTTTGGC
CACGACGTCAACGACCTGCCTCTCGACAGCTACTGCGACCAGATCGCCGCCGACCTCGATATCATCGCCTCTATT
GACACGCGTGAGCCTCGCGCCTTTCTCACCAGCCGCCGCAACCGACCGCTGCACCCAGTCAGCACGGCGCCTTAT
GATATCTGGCTTCAGCGAGACGAGCAGAGGCTTCGAGAGGCGGTCCGGCAGAAGCCTGCTGCCCGGTTCGAAGGC
GCGAGATGGGGAAAGAATAACGGAAGCAAGGTCAGCGCGGGCTCTGGTAGCCTTGCGAGCAACAACAACAACAAC
AACAACAACAACAACAACAACAACAACAGCGGCAGCAGCAGCGGCAGCAGCAGAATCAGCAGCAGCAGCAGCAGC
AGAATCAGCAGCAGCGAGAAGCAGGGCTGA
Gene >Ophcf2|07012
ATGGACGACGGCGGCCGGCTCCAGTCGCCCCGCAGCCCCGTCTCGGCCTCTTCTCCGCCGACGTCTCCGCCGACC
GGCCCCGGCCCCGGCCCCGAACCGTCTGCCCGTCATCATGGCTCGGGCCTCGATCTCAATGACTACTTCACCGGT
CCGCGCGATATGGCGCGTCACAGCCGCTGGCCGCTCTTGCTGCGGCTTCACGGCAGCATCCTCCCAAAGCTGATC
TTGCCAGTCGTTCTCATCAGCATCTGGAGCGCCACCATCACCATCGTGTCCATAAAGGTGCACCCGCTAGGCGTA
CACTCGGTGCTGCTGACGCTTACGGGCTTCGTCGTCTCGCTGTCGCTGTCGTTTCGATGCTCGACTGCTTACGAG
CGCTACTCGGAGGGTCGCAAGTACTGGACAGGTCTCGTCCAGGCCTCGCACGTTCTTGGTCGAGTCTTCTGGATT
CATGCCAAGGACGGACCGGATATGGATCCTCGCGAGGGCTTGTTGCTGCGGCTGACGTCGATGAACCTGGTCGTT
GCCTTTGCTCTCTCGCTCAAACATGGCCTGCGCTTCGAGCCCTACCTCTATCCAGACATGGCCACCCTTGTCGAC
CATCTCAATACGTGGGCGTCTGCGGCGACGACGATGACGACGACGACGACGACGACGACGACAACTGATGATCCG
TCTGGTTCCCGTCTTCGTCGCCGTCGCTTCTTCCATAGCGTGGGCGAGTATCTCGGCCTCTCCTTTACAGCCAGC
AACCCGCGAAAGGCGCTCAAACGAGCCACCCAGCCGCTGGGCCACCTCCCGCTCGAGATTCTCGGTCATCTGGCC
ATCGCCATCGACGCCCTCGTCGCCGACCAGCAGTTGACGGTGCCGGCGCACCAGACGTTGGCCTACAACGCCTTA
CAGTCGCTCAACGACGTCATGACGGGCACCGAACGGGTTCTCTGCACGCCCCTGCCCATCGCCTACTCCATCGCC
ATCTCCCAGGCCACTTACCTGTATCTGGCCCTGCTGCCCTTTCAGCTGATCCCGCTGCTGCACTGGATCGCCATC
CCCGCCACCATTGCCGCCTCGTGCATCATCCTCAGCCTGCTCTTCATCGGCCAGGAGATTGAGGACCCCTTTGGC
CACGACGTCAACGACCTGCCTCTCGACAGCTACTGCGACCAGATCGCCGCCGACCTCGATATCATCGCCTCTATT
GACACGCGTGAGCCTCGCGCCTTTCTCACCAGCCGCCGCAACCGACCGCTGCACCCAGTCAGCACGGCGCCTTAT
GATATCTGGCTTCAGCGAGACGAGCAGAGGCTTCGAGAGGCGGTCCGGCAGAAGCCTGCTGCCCGGTTCGAAGGC
GCGAGATGGGGAAAGAATAACGGAAGCAAGGTCAGCGCGGGCTCTGGTAGCCTTGCGAGCAACAACAACAACAAC
AACAACAACAACAACAACAACAACAACAGCGGCAGCAGCAGCGGCAGCAGCAGAATCAGCAGCAGCAGCAGCAGC
AGAATCAGCAGCAGCGAGAAGCAGGGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail