Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|07011
Gene name
Locationscaffold_09:350025..351337
Strand-
Gene length (bp)1312
Transcript length (bp)1164
Coding sequence length (bp)1164
Protein length (aa) 388

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12697 Abhydrolase_6 Alpha/beta hydrolase family 3.7E-09 90 356
PF12146 Hydrolase_4 Serine aminopeptidase, S33 1.5E-06 122 306

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.1191 0.0937 0.9306 0.0963 0.1576 0.0502 0.1353 0.3517 0.0711 0.0138

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup870
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4213
Ophiocordyceps australis map64 (Brazil) OphauB2|208
Ophiocordyceps camponoti-floridani Ophcf2|07011 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|667
Ophiocordyceps kimflemingae Ophio5|6686
Ophiocordyceps subramaniannii Hirsu2|4952
Ophiocordyceps subramaniannii Hirsu2|8371

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|07011
MSATVAILGLAVTAAARNCIDIAVSVALRPQQVRFEIQPPTTEIGIVDLILDATVQLPVIPPTQVTQTKTYRLAT
TYCSPDSGPGKGLQILTHGLGFDKAYWDWDAGPINGGRIYSYVDHALSHGYATLSWDRVGFGGSSRGHPIDEIQL
FLELDALAALTSWVRRGGLPGGQHRGSKLVHVGHSFGSALTAMVASQHPGLTDGIVLTGFSQVYAFLPNFILASN
FISVKKRPWLSVSYSEGYVTPQSAVGVQTDFFGPHNFDPVVMYQATARRVPIALGEMMTLAYVSSESNFTGPVLI
ITGNRDLPFCGGNCSNPAIINNMAANLLEAARPNFASASVLETNVVPRAGHALNLEFTAPLTYDMVLDFIDRNLP
SSYGSRPFGPRQ*
Coding >Ophcf2|07011
ATGTCTGCGACCGTCGCTATCCTCGGCCTCGCCGTTACGGCTGCAGCGCGAAACTGCATCGATATTGCTGTTTCT
GTTGCGCTGCGGCCGCAGCAGGTTCGGTTTGAGATCCAACCTCCCACGACTGAAATCGGTATCGTCGACTTGATT
CTCGACGCTACCGTCCAGCTCCCCGTCATTCCGCCGACGCAGGTCACGCAGACAAAGACATATCGACTGGCAACG
ACCTACTGCTCCCCCGACTCGGGTCCAGGCAAAGGCCTCCAAATCCTCACCCACGGCCTAGGCTTCGACAAAGCC
TACTGGGATTGGGACGCCGGCCCGATCAACGGCGGCCGCATATACAGCTACGTCGACCACGCCCTCTCCCACGGC
TACGCGACCCTCTCCTGGGATCGCGTAGGCTTCGGCGGCTCTTCACGCGGCCACCCCATCGACGAGATCCAGCTC
TTCCTCGAGCTAGACGCCCTGGCTGCCCTCACGAGCTGGGTGCGTCGCGGTGGCTTACCGGGTGGCCAGCATCGG
GGAAGCAAGCTTGTTCACGTTGGGCACAGCTTTGGGTCCGCTTTGACGGCCATGGTTGCGTCTCAGCATCCTGGG
CTGACGGATGGTATCGTCTTGACGGGATTCAGCCAGGTCTACGCCTTCTTGCCCAACTTTATCCTCGCATCCAAC
TTCATCTCTGTCAAGAAGAGACCCTGGCTGTCTGTCAGCTATTCTGAAGGCTACGTCACTCCTCAGTCGGCTGTC
GGGGTGCAGACCGACTTCTTTGGTCCTCACAACTTTGACCCGGTTGTCATGTATCAAGCCACGGCCAGACGAGTT
CCCATCGCGCTGGGCGAGATGATGACGCTGGCGTACGTGTCAAGCGAGAGCAACTTCACAGGACCAGTCTTGATA
ATCACCGGAAATCGAGACCTACCGTTTTGCGGAGGAAACTGCTCCAACCCAGCCATCATCAATAACATGGCTGCC
AACCTTCTCGAAGCGGCGCGCCCCAACTTTGCCTCTGCGAGCGTCTTGGAGACCAACGTCGTGCCCCGAGCCGGT
CATGCCCTCAACTTGGAATTCACGGCTCCTCTCACGTACGATATGGTTCTCGATTTCATCGACAGGAACCTACCG
TCTTCTTACGGCTCACGTCCGTTCGGGCCTCGACAGTGA
Transcript >Ophcf2|07011
ATGTCTGCGACCGTCGCTATCCTCGGCCTCGCCGTTACGGCTGCAGCGCGAAACTGCATCGATATTGCTGTTTCT
GTTGCGCTGCGGCCGCAGCAGGTTCGGTTTGAGATCCAACCTCCCACGACTGAAATCGGTATCGTCGACTTGATT
CTCGACGCTACCGTCCAGCTCCCCGTCATTCCGCCGACGCAGGTCACGCAGACAAAGACATATCGACTGGCAACG
ACCTACTGCTCCCCCGACTCGGGTCCAGGCAAAGGCCTCCAAATCCTCACCCACGGCCTAGGCTTCGACAAAGCC
TACTGGGATTGGGACGCCGGCCCGATCAACGGCGGCCGCATATACAGCTACGTCGACCACGCCCTCTCCCACGGC
TACGCGACCCTCTCCTGGGATCGCGTAGGCTTCGGCGGCTCTTCACGCGGCCACCCCATCGACGAGATCCAGCTC
TTCCTCGAGCTAGACGCCCTGGCTGCCCTCACGAGCTGGGTGCGTCGCGGTGGCTTACCGGGTGGCCAGCATCGG
GGAAGCAAGCTTGTTCACGTTGGGCACAGCTTTGGGTCCGCTTTGACGGCCATGGTTGCGTCTCAGCATCCTGGG
CTGACGGATGGTATCGTCTTGACGGGATTCAGCCAGGTCTACGCCTTCTTGCCCAACTTTATCCTCGCATCCAAC
TTCATCTCTGTCAAGAAGAGACCCTGGCTGTCTGTCAGCTATTCTGAAGGCTACGTCACTCCTCAGTCGGCTGTC
GGGGTGCAGACCGACTTCTTTGGTCCTCACAACTTTGACCCGGTTGTCATGTATCAAGCCACGGCCAGACGAGTT
CCCATCGCGCTGGGCGAGATGATGACGCTGGCGTACGTGTCAAGCGAGAGCAACTTCACAGGACCAGTCTTGATA
ATCACCGGAAATCGAGACCTACCGTTTTGCGGAGGAAACTGCTCCAACCCAGCCATCATCAATAACATGGCTGCC
AACCTTCTCGAAGCGGCGCGCCCCAACTTTGCCTCTGCGAGCGTCTTGGAGACCAACGTCGTGCCCCGAGCCGGT
CATGCCCTCAACTTGGAATTCACGGCTCCTCTCACGTACGATATGGTTCTCGATTTCATCGACAGGAACCTACCG
TCTTCTTACGGCTCACGTCCGTTCGGGCCTCGACAGTGA
Gene >Ophcf2|07011
ATGTCTGCGACCGTCGCTATCCTCGGCCTCGCCGTTACGGCTGCAGCGCGAAACTGCATCGATATTGCTGTTTCT
GTTGCGCTGCGGCCGCAGCAGGTTCGGTTTGAGATCCAACCTCCCACGACTGAAATCGGTATCGTCGACTTGATT
CTCGACGCTACCGTCCAGCTCCCCGTCATTCCGCCGACGCAGGTCACGCAGGTACGGATACAACAACAGCAGAGA
TGACACATTGAAAACCGATGAACCAACTAACAAGGACAATCTTTCACAGACAAAGACATATCGACTGGCAACGAC
CTACTGCTCCCCCGACTCGGGTCCAGGCAAAGGCCTCCAAATCCTCACCCACGGCCTAGGCTTCGACAAAGCCTA
CTGGGATTGGGACGCCGGCCCGATCAACGGCGGCCGCATATACAGCTACGTCGACCACGCCCTCTCCCACGGCTA
CGCGACCCTCTCCTGGGATCGCGTAGGCTTCGGCGGCTCTTCACGCGGCCACCCCATCGACGAGATCCAGCTCTT
CCTCGAGCTAGACGCCCTGGCTGCCCTCACGAGCTGGGTGCGTCGCGGTGGCTTACCGGGTGGCCAGCATCGGGG
AAGCAAGCTTGTTCACGTTGGGCACAGCTTTGGGTCCGCTTTGACGGCCATGGTTGCGTCTCAGCATCCTGGGCT
GACGGATGGTATCGTCTTGACGGGATTCAGCCAGGTCTACGCCTTCTTGCCCAACTTTATCCTCGCATCCAACTT
CATCTCTGTCAAGAAGAGACCCTGGCTGTCTGTCAGCTATTCTGAAGGCTACGTCACTCCTCAGTCGGCTGTCGG
GGTGCAGACCGACTTCTTTGGTCCTCACAACTTTGACCCGGTTGTCATGTATCAAGCCACGGCCAGACGAGTTCC
CATCGCGCTGGGCGAGATGATGACGCTGGCGTACGTGTCAAGCGAGAGCAACTTCACAGGACCAGTCTTGATAAT
CACCGGAAGCGAGTATACCCTCTTCTCTCCCTCTTTGTTCGTCTATTCTTCAGCTAATAACGGCTCGAGGCAAAC
GTGGATAGATCGAGACCTACCGTTTTGCGGAGGAAACTGCTCCAACCCAGCCATCATCAATAACATGGCTGCCAA
CCTTCTCGAAGCGGCGCGCCCCAACTTTGCCTCTGCGAGCGTCTTGGAGACCAACGTCGTGCCCCGAGCCGGTCA
TGCCCTCAACTTGGAATTCACGGCTCCTCTCACGTACGATATGGTTCTCGATTTCATCGACAGGAACCTACCGTC
TTCTTACGGCTCACGTCCGTTCGGGCCTCGACAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail