Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|07008
Gene name
Locationscaffold_09:341148..342794
Strand-
Gene length (bp)1646
Transcript length (bp)1575
Coding sequence length (bp)1575
Protein length (aa) 525

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01163 RIO1 RIO1 family 2.7E-67 155 346

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.5558 0.6869 0.0208 0.0563 0.2016 0.0034 0.1774 0.0306 0.0882 0.0021

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3622
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|256
Ophiocordyceps australis map64 (Brazil) OphauB2|205
Ophiocordyceps camponoti-floridani Ophcf2|07008 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|670
Ophiocordyceps kimflemingae Ophio5|6683
Ophiocordyceps subramaniannii Hirsu2|6997

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|07008
MSSAAASPPSGPQQPSNSVGTSHGDEPVHKVPPPQEESFDEPSLDDDDLDGVFSDADDGDEQGWSSYGRNRQPQQ
KPKVNTLASVDDQVAALARHAAKIRLDSVKRDDDREKDKADRATSDQVLDRRTRMILLQMINRGNVSEVHGAIST
GKEANVYGAVLYSDADQGPVQRAVKVYKTAILVFKDRERYINGEHRFRGGFDKGNSRKMVKLWAEKEFRNLRRIY
AAGIPCPEPIALKLHVLLMGFLGDARGWAYPKLRDALPDAETGDARWRLLYTQLLAIMRRMYQVCRLVHADLSEY
NVLCHQDKLYVIDVSQSVEPDHPRSLEFLRMDIKNVGDFFRRKGVDPLPDRAVFDFITTSAGPVDEPSMLEAIER
LYETADDEERDAAEVEIDNEVFRRQYIPQTLEQVYDVEKDGQKLARGEGDELVYRNLLADEVVGARRSSDVKESD
SGSDSGSDAGADLSNLGHDGFEKGRPRGRRFEDKEEKKTHKQAVKEAKREKRKTKVPKYEKKKMIASTSRKKKS*
Coding >Ophcf2|07008
ATGTCGAGCGCCGCAGCCTCGCCTCCGTCGGGGCCTCAACAGCCCTCCAACAGTGTAGGTACCAGCCACGGCGAC
GAACCGGTTCACAAAGTGCCACCGCCACAGGAGGAGTCATTTGACGAGCCCAGCCTCGACGATGACGATCTCGAC
GGCGTCTTCTCCGATGCCGACGATGGCGATGAACAGGGCTGGTCGTCTTACGGTCGAAATCGTCAGCCCCAGCAG
AAGCCAAAGGTCAACACGCTCGCCAGCGTCGACGATCAGGTAGCTGCTCTCGCCAGACACGCGGCCAAGATTCGT
CTCGATAGCGTCAAGCGCGACGATGACCGCGAGAAGGACAAAGCCGACCGCGCCACCAGCGACCAGGTGCTGGAT
CGCCGCACGCGCATGATTCTTTTGCAGATGATCAATCGCGGAAACGTCAGCGAAGTTCACGGCGCCATCAGCACC
GGCAAGGAGGCCAACGTCTACGGTGCCGTCCTATATAGTGATGCCGACCAAGGCCCTGTACAGCGCGCCGTCAAG
GTCTACAAGACGGCCATCCTCGTCTTCAAGGATCGCGAGAGATACATTAACGGCGAGCACCGCTTTCGTGGCGGC
TTCGACAAGGGCAACAGTCGCAAGATGGTCAAGCTCTGGGCGGAAAAGGAGTTTCGCAACCTGCGGAGGATCTAC
GCCGCCGGCATCCCCTGCCCGGAGCCCATCGCTCTCAAGCTGCACGTGCTCCTCATGGGCTTTCTCGGCGACGCA
CGGGGCTGGGCCTATCCGAAGCTTCGCGACGCCCTTCCAGATGCCGAGACCGGCGATGCGCGCTGGCGCCTCTTA
TACACGCAGCTCCTGGCTATCATGCGCAGGATGTACCAGGTCTGCCGCCTGGTCCACGCTGACCTGAGCGAGTAC
AATGTCTTGTGTCACCAAGACAAGCTGTACGTCATTGACGTGTCTCAGAGCGTCGAGCCCGATCACCCGCGCTCG
CTCGAGTTCCTGCGTATGGATATCAAGAACGTGGGCGATTTTTTCCGCCGCAAAGGCGTCGATCCGCTTCCAGAT
CGGGCCGTCTTTGACTTTATTACGACGTCCGCGGGTCCTGTCGACGAGCCCTCTATGCTCGAGGCCATCGAGCGG
CTCTACGAAACTGCCGATGACGAGGAGCGAGACGCTGCCGAGGTCGAAATTGATAACGAAGTCTTTCGCCGACAG
TATATCCCGCAGACGTTGGAGCAAGTCTACGACGTCGAAAAGGACGGGCAGAAGCTCGCGCGGGGGGAAGGCGAC
GAGCTGGTATACCGCAACCTACTCGCGGACGAGGTTGTGGGCGCGCGTCGCTCCTCAGACGTGAAGGAGTCCGAC
TCAGGCTCTGATTCGGGGTCCGACGCAGGCGCCGATCTGTCGAACTTGGGACACGATGGTTTCGAAAAGGGCCGG
CCTAGAGGTCGTCGGTTCGAGGACAAGGAGGAGAAGAAGACGCACAAACAAGCAGTCAAAGAAGCGAAGCGGGAG
AAGAGAAAGACAAAGGTGCCCAAGTACGAAAAGAAGAAGATGATAGCTAGCACTTCACGCAAGAAGAAGAGCTAG
Transcript >Ophcf2|07008
ATGTCGAGCGCCGCAGCCTCGCCTCCGTCGGGGCCTCAACAGCCCTCCAACAGTGTAGGTACCAGCCACGGCGAC
GAACCGGTTCACAAAGTGCCACCGCCACAGGAGGAGTCATTTGACGAGCCCAGCCTCGACGATGACGATCTCGAC
GGCGTCTTCTCCGATGCCGACGATGGCGATGAACAGGGCTGGTCGTCTTACGGTCGAAATCGTCAGCCCCAGCAG
AAGCCAAAGGTCAACACGCTCGCCAGCGTCGACGATCAGGTAGCTGCTCTCGCCAGACACGCGGCCAAGATTCGT
CTCGATAGCGTCAAGCGCGACGATGACCGCGAGAAGGACAAAGCCGACCGCGCCACCAGCGACCAGGTGCTGGAT
CGCCGCACGCGCATGATTCTTTTGCAGATGATCAATCGCGGAAACGTCAGCGAAGTTCACGGCGCCATCAGCACC
GGCAAGGAGGCCAACGTCTACGGTGCCGTCCTATATAGTGATGCCGACCAAGGCCCTGTACAGCGCGCCGTCAAG
GTCTACAAGACGGCCATCCTCGTCTTCAAGGATCGCGAGAGATACATTAACGGCGAGCACCGCTTTCGTGGCGGC
TTCGACAAGGGCAACAGTCGCAAGATGGTCAAGCTCTGGGCGGAAAAGGAGTTTCGCAACCTGCGGAGGATCTAC
GCCGCCGGCATCCCCTGCCCGGAGCCCATCGCTCTCAAGCTGCACGTGCTCCTCATGGGCTTTCTCGGCGACGCA
CGGGGCTGGGCCTATCCGAAGCTTCGCGACGCCCTTCCAGATGCCGAGACCGGCGATGCGCGCTGGCGCCTCTTA
TACACGCAGCTCCTGGCTATCATGCGCAGGATGTACCAGGTCTGCCGCCTGGTCCACGCTGACCTGAGCGAGTAC
AATGTCTTGTGTCACCAAGACAAGCTGTACGTCATTGACGTGTCTCAGAGCGTCGAGCCCGATCACCCGCGCTCG
CTCGAGTTCCTGCGTATGGATATCAAGAACGTGGGCGATTTTTTCCGCCGCAAAGGCGTCGATCCGCTTCCAGAT
CGGGCCGTCTTTGACTTTATTACGACGTCCGCGGGTCCTGTCGACGAGCCCTCTATGCTCGAGGCCATCGAGCGG
CTCTACGAAACTGCCGATGACGAGGAGCGAGACGCTGCCGAGGTCGAAATTGATAACGAAGTCTTTCGCCGACAG
TATATCCCGCAGACGTTGGAGCAAGTCTACGACGTCGAAAAGGACGGGCAGAAGCTCGCGCGGGGGGAAGGCGAC
GAGCTGGTATACCGCAACCTACTCGCGGACGAGGTTGTGGGCGCGCGTCGCTCCTCAGACGTGAAGGAGTCCGAC
TCAGGCTCTGATTCGGGGTCCGACGCAGGCGCCGATCTGTCGAACTTGGGACACGATGGTTTCGAAAAGGGCCGG
CCTAGAGGTCGTCGGTTCGAGGACAAGGAGGAGAAGAAGACGCACAAACAAGCAGTCAAAGAAGCGAAGCGGGAG
AAGAGAAAGACAAAGGTGCCCAAGTACGAAAAGAAGAAGATGATAGCTAGCACTTCACGCAAGAAGAAGAGCTAG
Gene >Ophcf2|07008
ATGTCGAGCGCCGCAGCCTCGCCTCCGTCGGGGCCTCAACAGCCCTCCAACAGTGTAGGTACCAGCCACGGCGAC
GAACCGGTTCACAAAGTGCCACCGCCACAGGAGGAGTCATTTGACGAGCCCAGCCTCGACGATGACGATCTCGAC
GGCGTCTTCTCCGATGCCGACGATGGCGATGAACAGGGCTGGTCGTCTTACGGTCGAAATCGTCAGCCCCAGCAG
AAGCCAAAGGTCAACACGCTCGCCAGCGTCGACGATCAGGTAGCTGCTCTCGCCAGACACGCGGCCAAGATTCGT
CTCGATAGCGTCAAGCGCGACGATGACCGCGAGAAGGACAAAGCCGACCGCGCCACCAGCGACCAGGTGCTGGAT
CGCCGCACGCGCATGATTCTTTTGCAGATGATCAATCGCGGAAACGTCAGCGAAGTTCACGGCGCCATCAGCACC
GGCAAGGAGGCCAACGTCTACGGTGCCGTCCTATATAGTGATGCCGACCAAGGCCCTGTACAGCGCGCCGTCAAG
GTCTACAAGACGGCCATCCTCGTCTTCAAGGATCGCGAGAGATACATTAACGGCGAGCACCGCTTTCGTGGCGGC
TTCGACAAGGGCAACAGTCGCAAGATGGTCAAGCTCTGGGCGGAAAAGGAGTTTCGCAACCTGCGGAGGATCTAC
GCCGCCGGCATCCCCTGCCCGGAGCCCATCGCTCTCAAGCTGCACGTGCTCCTCATGGGCTTTCTCGGCGACGCA
CGGGGCTGGGCCTATCCGAAGCTTCGCGACGCCCTTCCAGATGCCGAGACCGGCGATGCGCGCTGGCGCCTCTTA
TACACGCAGCTCCTGGCTATCATGCGCAGGATGTACCAGGTCTGCCGCCTGGTCCACGCTGACCTGAGCGAGTAC
AATGTCTTGTGTCACCAAGACAAGCTGTACGTCATTGACGTGTCTCAGAGCGTCGAGCCCGATCACCCGCGCTCG
CTCGAGTTCCTGCGTATGGATATCAAGAACGTGGGCGATTTTTTCCGCCGCAAAGGCGTCGATCCGCTTCCAGAT
CGGGCCGTCTTTGACTTTATTACGACGTCCGCGGGTCCTGTCGACGAGCCCTCTATGCTCGAGGCCATCGAGCGG
CTCTACGAAACTGCCGATGACGAGGAGCGAGACGCTGCCGAGGTCGAAATTGATAACGAAGTCTTTCGCCGACAG
TATATCCCGCAGACGTTGGAGCAAGTCTACGACGTCGAAAAGGACGGGCAGAAGCTCGCGCGGGGGGAAGGCGAC
GAGCTGGTATACCGCAACCTACTCGCGGACGAGGTTGTGGGCGCGCGTCGCTCCTCAGACGTGAAGGAGTCCGAC
TCAGGCTCTGATTCGGGGTCCGACGCAGGCGCCGATCTGTCGAACTTGGGACACGATGGTTTCGAAAAGGGCCGG
CCTAGAGGTCGTCGGTTCGAGGACAAGGAGGAGAAGAAGGTGATTTGCCAGCTTTGCACTTACTCACTGTTCCTC
CAGCGCCGTCGACGCTCTGGCTAACTCATCGGCAGACGCACAAACAAGCAGTCAAAGAAGCGAAGCGGGAGAAGA
GAAAGACAAAGGTGCCCAAGTACGAAAAGAAGAAGATGATAGCTAGCACTTCACGCAAGAAGAAGAGCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail