Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|07006
Gene name
Locationscaffold_09:334178..337799
Strand-
Gene length (bp)3621
Transcript length (bp)3621
Coding sequence length (bp)3621
Protein length (aa) 1207

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05183 RdRP RNA dependent RNA polymerase 2.1E-103 358 1003

GO

GO Term Description Terminal node
GO:0003968 RNA-directed 5'-3' RNA polymerase activity Yes
GO:0140098 catalytic activity, acting on RNA No
GO:0097747 RNA polymerase activity No
GO:0034062 5'-3' RNA polymerase activity No
GO:0016779 nucleotidyltransferase activity No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0016740 transferase activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3851 0.8999 0.384 0.0169 0.1086 0.0093 0.023 0.0203 0.017 0.0021

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3623
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4865
Ophiocordyceps australis map64 (Brazil) OphauB2|262
Ophiocordyceps camponoti-floridani Ophcf2|07006 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|672
Ophiocordyceps kimflemingae Ophio5|6681
Ophiocordyceps subramaniannii Hirsu2|7000

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|07006
MPSPEGLKRIIDSLNADYGLFIRRIDVTLSPRKARNRLQASADEESFQAEKLYSFIHRLYYHDLSRLSAAIGRFR
QLAADSLGSSVPFAGSLQRRRLLMGRLLDVLDGKVPASNSKRSSKHHEDESRSKRPKSRDDCDPDLVDQLPVRSS
PPADTMDSISGRITSKSTSASILTYFESSRATIPTSSSRTSSASTVVEDDYPVNGDLLVSSQDYRDLLDKMDKIP
NSTGATPQSFSFKSSASVPRVESLEQKFKRMWPKVCVRGLDMAPLPVLWEVTRIFQHCQVESETCNMAYDEGWVD
QHLLRRTLAGHPAFAGKALPVASDSKAWALACRGLLGKTHQVCFSIELVMRPVAKGLFPLEMRLSPLTLEPSHRL
ARRFGADRCLEMTIPDPQYLERELIKAAGGDSSFQIRFNRWLHNGHLHPFASRLWFPYFFSRKKSQGAAMYRIYF
FASDGHHFRESPVGALPPPGEASDPLLRTKLRPEGLLHWAVAIKRPENLAMSAVKLFSRLSISHTRTYSNVELLP
EQIRFLKRDLGTHDIMNDGLGRMSKALARKIADDLGLSDTPCGYQGRIGSAKGFWIIDVESDLNDGDIWIELYPS
QIKWLCDFDDISHRTFEVKDYPREAKPGAALNQQFLPLLEAQARDRLAMRRHLEQTLRANLVADLDALDGALDSA
YDLRLWLRQVGQTSSSQGGPSFLAGLPRTCEDQVAQLLDAGFQPRRQQYMYDLCLNIGTRKAETLRKSKLHVSVA
QATYLFMVADFWGVLEEGQVSVNFSSKFEAHGFCDTALDGLDVLVARNPAHTLSDMQKVMTVAHPKLRRLKDVIV
FSTKGTKPLAALLSGGDYDGDKCWVCWDRNIVDNFKGCPADEQAGTLKMTKLEMTVDQLVPAVGRERHCWKSLCN
KFTFLGFQFSFQPDMLGKCTKYKERLDYLRGVTGPHMAKLAALLSNLVDQAKQGVIFNEPKWRTFCEEELQLGPW
LDDPAYFEERCEKPDRLGDDSPLLDVLKFKVAKPAIDDSLEKLTRAMRAHKDTPQYYDADLTALFGRFDSRRREC
PVIHRLLTDLRNDLEVVAHEWGLKSQSKDEKFIPNCQEVFASWLAVEPRPELQASGQLQRFLWDWDPNVSARRLR
VMSEWNRLKASATFKTYHNSKPNFVWRMAGSWLCHLKELEGCGGVVPAAVVKQEMYGCLRPNKKMVRKRIRERGE
EDDGMC*
Coding >Ophcf2|07006
ATGCCTTCGCCTGAAGGACTGAAGCGGATCATCGACAGTCTCAATGCCGATTACGGTCTCTTTATTCGGAGGATA
GACGTCACTCTTTCGCCGAGGAAGGCTAGGAATAGGTTGCAGGCTTCGGCTGACGAGGAGAGCTTCCAGGCCGAG
AAGCTGTACAGCTTCATTCATCGCCTGTACTATCACGACTTGAGTCGGCTGTCGGCTGCCATCGGCAGATTCCGT
CAATTGGCAGCTGATAGTCTCGGCTCGTCCGTCCCCTTCGCCGGCTCGCTTCAGCGGAGACGCCTTCTCATGGGC
CGTCTGCTCGATGTCTTGGATGGAAAGGTTCCCGCGTCGAACTCGAAGCGGAGTTCGAAGCATCATGAGGACGAG
TCACGGTCCAAGCGGCCAAAATCTCGAGATGACTGCGATCCTGATTTGGTTGATCAGCTGCCTGTTCGGAGTTCT
CCTCCGGCGGATACCATGGACAGCATCAGCGGCCGGATTACGTCCAAGTCGACATCAGCTTCTATTCTCACGTAT
TTCGAGAGCAGCCGCGCCACCATACCGACGTCTTCCTCCAGAACCTCGTCTGCGTCTACCGTCGTGGAAGATGAC
TATCCCGTCAACGGTGACTTGCTCGTCAGCTCGCAGGATTATCGAGACCTCCTCGACAAGATGGACAAGATCCCC
AACTCAACAGGCGCCACTCCTCAGAGCTTCTCCTTCAAGTCCTCCGCCAGTGTGCCGAGGGTCGAGTCTCTCGAG
CAGAAATTCAAGCGCATGTGGCCCAAAGTCTGTGTCCGGGGCCTTGACATGGCTCCCTTGCCCGTCTTATGGGAG
GTGACGCGCATCTTTCAGCACTGTCAAGTCGAGTCTGAAACCTGCAACATGGCATACGATGAAGGATGGGTCGAC
CAGCATCTTCTTCGCAGAACCCTGGCCGGCCATCCGGCATTTGCGGGCAAAGCTCTGCCCGTTGCCAGTGACTCC
AAGGCGTGGGCTTTGGCCTGCCGCGGCTTGTTGGGCAAAACCCACCAAGTCTGCTTCTCGATTGAACTCGTGATG
CGGCCCGTTGCCAAAGGCTTGTTCCCCTTGGAGATGCGGTTGAGCCCGCTGACGCTGGAGCCGAGTCACCGGCTT
GCGCGAAGGTTCGGGGCCGACCGCTGTCTCGAGATGACGATTCCCGATCCGCAATATCTGGAAAGGGAGCTCATC
AAGGCTGCTGGTGGAGATTCCAGTTTCCAAATCAGGTTCAACAGGTGGCTGCACAACGGCCATCTCCATCCCTTT
GCCAGCCGCCTCTGGTTTCCCTACTTCTTCTCCAGGAAGAAGAGCCAAGGCGCGGCCATGTACAGGATCTACTTC
TTCGCTTCGGACGGACATCACTTCCGCGAGTCTCCTGTCGGCGCCTTGCCCCCCCCGGGAGAGGCTTCGGATCCC
CTGTTGCGTACCAAGCTGAGGCCCGAGGGTCTCCTGCATTGGGCCGTCGCCATCAAGAGGCCGGAGAACTTGGCC
ATGTCGGCGGTCAAGCTCTTCTCGCGGCTATCCATCAGCCACACGCGGACCTATTCTAACGTAGAGTTGTTGCCG
GAACAGATTCGGTTTCTGAAAAGGGACCTGGGAACGCACGACATCATGAACGACGGCCTGGGACGCATGTCCAAG
GCGCTGGCCAGGAAGATTGCTGATGATCTTGGCTTGTCCGACACGCCTTGCGGATATCAGGGACGGATAGGCAGC
GCCAAGGGCTTCTGGATCATCGACGTCGAGTCTGACCTCAACGATGGCGATATCTGGATCGAGCTGTACCCGTCA
CAGATCAAGTGGCTTTGCGACTTCGACGACATCTCGCACCGCACCTTCGAGGTCAAGGACTATCCGCGAGAGGCC
AAGCCGGGAGCGGCGCTGAACCAGCAGTTTCTACCGCTTCTCGAGGCCCAAGCCAGAGACCGGCTGGCGATGAGA
CGCCATCTCGAGCAGACGCTCAGGGCCAACCTCGTGGCTGACCTCGACGCGCTAGACGGAGCCCTGGATAGTGCT
TACGACCTACGACTGTGGCTGCGTCAGGTCGGTCAGACGTCGAGCTCACAGGGGGGTCCGTCATTCCTGGCCGGG
CTTCCGAGGACCTGCGAAGACCAAGTCGCTCAGCTGCTCGACGCCGGCTTCCAGCCCAGACGGCAGCAGTACATG
TACGACTTGTGCCTCAACATCGGGACGCGCAAGGCAGAGACGCTCCGGAAGAGCAAGCTGCACGTCTCCGTCGCT
CAGGCAACGTACCTGTTCATGGTGGCCGACTTCTGGGGCGTGCTGGAGGAGGGCCAAGTCTCGGTCAACTTCTCG
TCCAAGTTCGAGGCCCATGGCTTCTGCGACACGGCTCTCGACGGCCTGGATGTCCTGGTGGCGCGGAACCCGGCC
CATACTCTGTCGGACATGCAAAAGGTGATGACGGTCGCACATCCGAAGCTGCGGAGACTCAAGGACGTCATCGTC
TTCTCGACCAAGGGCACCAAGCCGCTGGCCGCCCTGCTCTCCGGCGGAGACTACGACGGAGACAAGTGCTGGGTC
TGCTGGGACCGCAACATCGTCGACAACTTCAAAGGCTGTCCGGCCGATGAGCAGGCGGGAACGTTGAAGATGACC
AAGCTGGAGATGACGGTCGACCAGCTCGTTCCGGCGGTAGGACGAGAGAGGCATTGTTGGAAGAGCTTGTGTAAT
AAGTTTACCTTTCTCGGCTTCCAGTTCTCCTTCCAGCCAGACATGCTCGGCAAGTGCACCAAGTATAAGGAGAGG
CTCGACTACCTACGTGGAGTGACGGGGCCTCACATGGCCAAGCTGGCGGCTCTCCTGAGCAACCTCGTCGACCAG
GCCAAGCAGGGCGTCATCTTCAACGAGCCGAAATGGAGGACGTTTTGCGAAGAGGAGCTCCAGCTGGGTCCCTGG
CTCGACGATCCAGCCTACTTTGAGGAGCGATGCGAGAAGCCCGACCGACTGGGAGACGACAGCCCACTCCTCGAC
GTCCTCAAGTTCAAGGTGGCCAAGCCGGCCATCGATGACTCGTTGGAGAAGCTCACTAGAGCCATGAGGGCTCAC
AAAGACACGCCGCAATACTACGACGCCGACCTGACTGCTCTCTTCGGACGCTTCGACTCGAGACGAAGAGAGTGC
CCCGTCATCCACCGACTCCTGACGGACCTACGCAACGACCTCGAAGTCGTGGCTCACGAGTGGGGGTTGAAGAGC
CAGAGCAAAGACGAAAAGTTCATCCCCAACTGCCAAGAGGTCTTTGCGTCGTGGCTGGCAGTCGAGCCGAGGCCC
GAGTTGCAGGCTTCGGGCCAGTTGCAGCGCTTCCTCTGGGATTGGGATCCCAACGTCTCGGCTCGACGACTGCGC
GTCATGAGCGAGTGGAACCGGCTCAAGGCGTCGGCGACGTTCAAGACCTATCACAACTCGAAGCCGAATTTCGTG
TGGCGGATGGCGGGCTCGTGGCTTTGTCATCTGAAGGAGTTGGAGGGTTGCGGAGGGGTGGTGCCGGCTGCGGTG
GTTAAGCAGGAGATGTATGGGTGTTTGCGGCCGAATAAGAAGATGGTAAGGAAGAGGATCAGGGAGAGGGGGGAG
GAGGACGATGGGATGTGTTGA
Transcript >Ophcf2|07006
ATGCCTTCGCCTGAAGGACTGAAGCGGATCATCGACAGTCTCAATGCCGATTACGGTCTCTTTATTCGGAGGATA
GACGTCACTCTTTCGCCGAGGAAGGCTAGGAATAGGTTGCAGGCTTCGGCTGACGAGGAGAGCTTCCAGGCCGAG
AAGCTGTACAGCTTCATTCATCGCCTGTACTATCACGACTTGAGTCGGCTGTCGGCTGCCATCGGCAGATTCCGT
CAATTGGCAGCTGATAGTCTCGGCTCGTCCGTCCCCTTCGCCGGCTCGCTTCAGCGGAGACGCCTTCTCATGGGC
CGTCTGCTCGATGTCTTGGATGGAAAGGTTCCCGCGTCGAACTCGAAGCGGAGTTCGAAGCATCATGAGGACGAG
TCACGGTCCAAGCGGCCAAAATCTCGAGATGACTGCGATCCTGATTTGGTTGATCAGCTGCCTGTTCGGAGTTCT
CCTCCGGCGGATACCATGGACAGCATCAGCGGCCGGATTACGTCCAAGTCGACATCAGCTTCTATTCTCACGTAT
TTCGAGAGCAGCCGCGCCACCATACCGACGTCTTCCTCCAGAACCTCGTCTGCGTCTACCGTCGTGGAAGATGAC
TATCCCGTCAACGGTGACTTGCTCGTCAGCTCGCAGGATTATCGAGACCTCCTCGACAAGATGGACAAGATCCCC
AACTCAACAGGCGCCACTCCTCAGAGCTTCTCCTTCAAGTCCTCCGCCAGTGTGCCGAGGGTCGAGTCTCTCGAG
CAGAAATTCAAGCGCATGTGGCCCAAAGTCTGTGTCCGGGGCCTTGACATGGCTCCCTTGCCCGTCTTATGGGAG
GTGACGCGCATCTTTCAGCACTGTCAAGTCGAGTCTGAAACCTGCAACATGGCATACGATGAAGGATGGGTCGAC
CAGCATCTTCTTCGCAGAACCCTGGCCGGCCATCCGGCATTTGCGGGCAAAGCTCTGCCCGTTGCCAGTGACTCC
AAGGCGTGGGCTTTGGCCTGCCGCGGCTTGTTGGGCAAAACCCACCAAGTCTGCTTCTCGATTGAACTCGTGATG
CGGCCCGTTGCCAAAGGCTTGTTCCCCTTGGAGATGCGGTTGAGCCCGCTGACGCTGGAGCCGAGTCACCGGCTT
GCGCGAAGGTTCGGGGCCGACCGCTGTCTCGAGATGACGATTCCCGATCCGCAATATCTGGAAAGGGAGCTCATC
AAGGCTGCTGGTGGAGATTCCAGTTTCCAAATCAGGTTCAACAGGTGGCTGCACAACGGCCATCTCCATCCCTTT
GCCAGCCGCCTCTGGTTTCCCTACTTCTTCTCCAGGAAGAAGAGCCAAGGCGCGGCCATGTACAGGATCTACTTC
TTCGCTTCGGACGGACATCACTTCCGCGAGTCTCCTGTCGGCGCCTTGCCCCCCCCGGGAGAGGCTTCGGATCCC
CTGTTGCGTACCAAGCTGAGGCCCGAGGGTCTCCTGCATTGGGCCGTCGCCATCAAGAGGCCGGAGAACTTGGCC
ATGTCGGCGGTCAAGCTCTTCTCGCGGCTATCCATCAGCCACACGCGGACCTATTCTAACGTAGAGTTGTTGCCG
GAACAGATTCGGTTTCTGAAAAGGGACCTGGGAACGCACGACATCATGAACGACGGCCTGGGACGCATGTCCAAG
GCGCTGGCCAGGAAGATTGCTGATGATCTTGGCTTGTCCGACACGCCTTGCGGATATCAGGGACGGATAGGCAGC
GCCAAGGGCTTCTGGATCATCGACGTCGAGTCTGACCTCAACGATGGCGATATCTGGATCGAGCTGTACCCGTCA
CAGATCAAGTGGCTTTGCGACTTCGACGACATCTCGCACCGCACCTTCGAGGTCAAGGACTATCCGCGAGAGGCC
AAGCCGGGAGCGGCGCTGAACCAGCAGTTTCTACCGCTTCTCGAGGCCCAAGCCAGAGACCGGCTGGCGATGAGA
CGCCATCTCGAGCAGACGCTCAGGGCCAACCTCGTGGCTGACCTCGACGCGCTAGACGGAGCCCTGGATAGTGCT
TACGACCTACGACTGTGGCTGCGTCAGGTCGGTCAGACGTCGAGCTCACAGGGGGGTCCGTCATTCCTGGCCGGG
CTTCCGAGGACCTGCGAAGACCAAGTCGCTCAGCTGCTCGACGCCGGCTTCCAGCCCAGACGGCAGCAGTACATG
TACGACTTGTGCCTCAACATCGGGACGCGCAAGGCAGAGACGCTCCGGAAGAGCAAGCTGCACGTCTCCGTCGCT
CAGGCAACGTACCTGTTCATGGTGGCCGACTTCTGGGGCGTGCTGGAGGAGGGCCAAGTCTCGGTCAACTTCTCG
TCCAAGTTCGAGGCCCATGGCTTCTGCGACACGGCTCTCGACGGCCTGGATGTCCTGGTGGCGCGGAACCCGGCC
CATACTCTGTCGGACATGCAAAAGGTGATGACGGTCGCACATCCGAAGCTGCGGAGACTCAAGGACGTCATCGTC
TTCTCGACCAAGGGCACCAAGCCGCTGGCCGCCCTGCTCTCCGGCGGAGACTACGACGGAGACAAGTGCTGGGTC
TGCTGGGACCGCAACATCGTCGACAACTTCAAAGGCTGTCCGGCCGATGAGCAGGCGGGAACGTTGAAGATGACC
AAGCTGGAGATGACGGTCGACCAGCTCGTTCCGGCGGTAGGACGAGAGAGGCATTGTTGGAAGAGCTTGTGTAAT
AAGTTTACCTTTCTCGGCTTCCAGTTCTCCTTCCAGCCAGACATGCTCGGCAAGTGCACCAAGTATAAGGAGAGG
CTCGACTACCTACGTGGAGTGACGGGGCCTCACATGGCCAAGCTGGCGGCTCTCCTGAGCAACCTCGTCGACCAG
GCCAAGCAGGGCGTCATCTTCAACGAGCCGAAATGGAGGACGTTTTGCGAAGAGGAGCTCCAGCTGGGTCCCTGG
CTCGACGATCCAGCCTACTTTGAGGAGCGATGCGAGAAGCCCGACCGACTGGGAGACGACAGCCCACTCCTCGAC
GTCCTCAAGTTCAAGGTGGCCAAGCCGGCCATCGATGACTCGTTGGAGAAGCTCACTAGAGCCATGAGGGCTCAC
AAAGACACGCCGCAATACTACGACGCCGACCTGACTGCTCTCTTCGGACGCTTCGACTCGAGACGAAGAGAGTGC
CCCGTCATCCACCGACTCCTGACGGACCTACGCAACGACCTCGAAGTCGTGGCTCACGAGTGGGGGTTGAAGAGC
CAGAGCAAAGACGAAAAGTTCATCCCCAACTGCCAAGAGGTCTTTGCGTCGTGGCTGGCAGTCGAGCCGAGGCCC
GAGTTGCAGGCTTCGGGCCAGTTGCAGCGCTTCCTCTGGGATTGGGATCCCAACGTCTCGGCTCGACGACTGCGC
GTCATGAGCGAGTGGAACCGGCTCAAGGCGTCGGCGACGTTCAAGACCTATCACAACTCGAAGCCGAATTTCGTG
TGGCGGATGGCGGGCTCGTGGCTTTGTCATCTGAAGGAGTTGGAGGGTTGCGGAGGGGTGGTGCCGGCTGCGGTG
GTTAAGCAGGAGATGTATGGGTGTTTGCGGCCGAATAAGAAGATGGTAAGGAAGAGGATCAGGGAGAGGGGGGAG
GAGGACGATGGGATGTGTTGA
Gene >Ophcf2|07006
ATGCCTTCGCCTGAAGGACTGAAGCGGATCATCGACAGTCTCAATGCCGATTACGGTCTCTTTATTCGGAGGATA
GACGTCACTCTTTCGCCGAGGAAGGCTAGGAATAGGTTGCAGGCTTCGGCTGACGAGGAGAGCTTCCAGGCCGAG
AAGCTGTACAGCTTCATTCATCGCCTGTACTATCACGACTTGAGTCGGCTGTCGGCTGCCATCGGCAGATTCCGT
CAATTGGCAGCTGATAGTCTCGGCTCGTCCGTCCCCTTCGCCGGCTCGCTTCAGCGGAGACGCCTTCTCATGGGC
CGTCTGCTCGATGTCTTGGATGGAAAGGTTCCCGCGTCGAACTCGAAGCGGAGTTCGAAGCATCATGAGGACGAG
TCACGGTCCAAGCGGCCAAAATCTCGAGATGACTGCGATCCTGATTTGGTTGATCAGCTGCCTGTTCGGAGTTCT
CCTCCGGCGGATACCATGGACAGCATCAGCGGCCGGATTACGTCCAAGTCGACATCAGCTTCTATTCTCACGTAT
TTCGAGAGCAGCCGCGCCACCATACCGACGTCTTCCTCCAGAACCTCGTCTGCGTCTACCGTCGTGGAAGATGAC
TATCCCGTCAACGGTGACTTGCTCGTCAGCTCGCAGGATTATCGAGACCTCCTCGACAAGATGGACAAGATCCCC
AACTCAACAGGCGCCACTCCTCAGAGCTTCTCCTTCAAGTCCTCCGCCAGTGTGCCGAGGGTCGAGTCTCTCGAG
CAGAAATTCAAGCGCATGTGGCCCAAAGTCTGTGTCCGGGGCCTTGACATGGCTCCCTTGCCCGTCTTATGGGAG
GTGACGCGCATCTTTCAGCACTGTCAAGTCGAGTCTGAAACCTGCAACATGGCATACGATGAAGGATGGGTCGAC
CAGCATCTTCTTCGCAGAACCCTGGCCGGCCATCCGGCATTTGCGGGCAAAGCTCTGCCCGTTGCCAGTGACTCC
AAGGCGTGGGCTTTGGCCTGCCGCGGCTTGTTGGGCAAAACCCACCAAGTCTGCTTCTCGATTGAACTCGTGATG
CGGCCCGTTGCCAAAGGCTTGTTCCCCTTGGAGATGCGGTTGAGCCCGCTGACGCTGGAGCCGAGTCACCGGCTT
GCGCGAAGGTTCGGGGCCGACCGCTGTCTCGAGATGACGATTCCCGATCCGCAATATCTGGAAAGGGAGCTCATC
AAGGCTGCTGGTGGAGATTCCAGTTTCCAAATCAGGTTCAACAGGTGGCTGCACAACGGCCATCTCCATCCCTTT
GCCAGCCGCCTCTGGTTTCCCTACTTCTTCTCCAGGAAGAAGAGCCAAGGCGCGGCCATGTACAGGATCTACTTC
TTCGCTTCGGACGGACATCACTTCCGCGAGTCTCCTGTCGGCGCCTTGCCCCCCCCGGGAGAGGCTTCGGATCCC
CTGTTGCGTACCAAGCTGAGGCCCGAGGGTCTCCTGCATTGGGCCGTCGCCATCAAGAGGCCGGAGAACTTGGCC
ATGTCGGCGGTCAAGCTCTTCTCGCGGCTATCCATCAGCCACACGCGGACCTATTCTAACGTAGAGTTGTTGCCG
GAACAGATTCGGTTTCTGAAAAGGGACCTGGGAACGCACGACATCATGAACGACGGCCTGGGACGCATGTCCAAG
GCGCTGGCCAGGAAGATTGCTGATGATCTTGGCTTGTCCGACACGCCTTGCGGATATCAGGGACGGATAGGCAGC
GCCAAGGGCTTCTGGATCATCGACGTCGAGTCTGACCTCAACGATGGCGATATCTGGATCGAGCTGTACCCGTCA
CAGATCAAGTGGCTTTGCGACTTCGACGACATCTCGCACCGCACCTTCGAGGTCAAGGACTATCCGCGAGAGGCC
AAGCCGGGAGCGGCGCTGAACCAGCAGTTTCTACCGCTTCTCGAGGCCCAAGCCAGAGACCGGCTGGCGATGAGA
CGCCATCTCGAGCAGACGCTCAGGGCCAACCTCGTGGCTGACCTCGACGCGCTAGACGGAGCCCTGGATAGTGCT
TACGACCTACGACTGTGGCTGCGTCAGGTCGGTCAGACGTCGAGCTCACAGGGGGGTCCGTCATTCCTGGCCGGG
CTTCCGAGGACCTGCGAAGACCAAGTCGCTCAGCTGCTCGACGCCGGCTTCCAGCCCAGACGGCAGCAGTACATG
TACGACTTGTGCCTCAACATCGGGACGCGCAAGGCAGAGACGCTCCGGAAGAGCAAGCTGCACGTCTCCGTCGCT
CAGGCAACGTACCTGTTCATGGTGGCCGACTTCTGGGGCGTGCTGGAGGAGGGCCAAGTCTCGGTCAACTTCTCG
TCCAAGTTCGAGGCCCATGGCTTCTGCGACACGGCTCTCGACGGCCTGGATGTCCTGGTGGCGCGGAACCCGGCC
CATACTCTGTCGGACATGCAAAAGGTGATGACGGTCGCACATCCGAAGCTGCGGAGACTCAAGGACGTCATCGTC
TTCTCGACCAAGGGCACCAAGCCGCTGGCCGCCCTGCTCTCCGGCGGAGACTACGACGGAGACAAGTGCTGGGTC
TGCTGGGACCGCAACATCGTCGACAACTTCAAAGGCTGTCCGGCCGATGAGCAGGCGGGAACGTTGAAGATGACC
AAGCTGGAGATGACGGTCGACCAGCTCGTTCCGGCGGTAGGACGAGAGAGGCATTGTTGGAAGAGCTTGTGTAAT
AAGTTTACCTTTCTCGGCTTCCAGTTCTCCTTCCAGCCAGACATGCTCGGCAAGTGCACCAAGTATAAGGAGAGG
CTCGACTACCTACGTGGAGTGACGGGGCCTCACATGGCCAAGCTGGCGGCTCTCCTGAGCAACCTCGTCGACCAG
GCCAAGCAGGGCGTCATCTTCAACGAGCCGAAATGGAGGACGTTTTGCGAAGAGGAGCTCCAGCTGGGTCCCTGG
CTCGACGATCCAGCCTACTTTGAGGAGCGATGCGAGAAGCCCGACCGACTGGGAGACGACAGCCCACTCCTCGAC
GTCCTCAAGTTCAAGGTGGCCAAGCCGGCCATCGATGACTCGTTGGAGAAGCTCACTAGAGCCATGAGGGCTCAC
AAAGACACGCCGCAATACTACGACGCCGACCTGACTGCTCTCTTCGGACGCTTCGACTCGAGACGAAGAGAGTGC
CCCGTCATCCACCGACTCCTGACGGACCTACGCAACGACCTCGAAGTCGTGGCTCACGAGTGGGGGTTGAAGAGC
CAGAGCAAAGACGAAAAGTTCATCCCCAACTGCCAAGAGGTCTTTGCGTCGTGGCTGGCAGTCGAGCCGAGGCCC
GAGTTGCAGGCTTCGGGCCAGTTGCAGCGCTTCCTCTGGGATTGGGATCCCAACGTCTCGGCTCGACGACTGCGC
GTCATGAGCGAGTGGAACCGGCTCAAGGCGTCGGCGACGTTCAAGACCTATCACAACTCGAAGCCGAATTTCGTG
TGGCGGATGGCGGGCTCGTGGCTTTGTCATCTGAAGGAGTTGGAGGGTTGCGGAGGGGTGGTGCCGGCTGCGGTG
GTTAAGCAGGAGATGTATGGGTGTTTGCGGCCGAATAAGAAGATGGTAAGGAAGAGGATCAGGGAGAGGGGGGAG
GAGGACGATGGGATGTGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail