Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06999
Gene name
Locationscaffold_09:320193..320691
Strand-
Gene length (bp)498
Transcript length (bp)498
Coding sequence length (bp)498
Protein length (aa) 166

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03061 4HBT Thioesterase superfamily 2.9E-14 60 134

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Peroxisome Peroxisomal targeting signal 0.4454 0.2364 0.0913 0.0082 0.0998 0.0037 0.291 0.1022 0.0639 0.9852

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup6484
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5037
Ophiocordyceps australis map64 (Brazil) OphauB2|4029
Ophiocordyceps camponoti-floridani Ophcf2|06999 (this protein)
Ophiocordyceps subramaniannii Hirsu2|1027

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06999
MAPDLPQAARLQHVEAVLQRLLTNSPIYGFTLSTLELVSVTQGKATTRLRLTERHVNSKGGLHGAVSATIFDLTT
GLAIASWDGRETTGASVDMHLSYLSTARVGDVLRIETTAERVGGSLAFVTVRMLKEGGERDEVVTLGQHTKYVKG
TAARGTTEDAAAVRR*
Coding >Ophcf2|06999
ATGGCTCCGGACCTACCACAAGCAGCCAGGCTGCAGCACGTCGAGGCAGTCCTGCAGCGTCTCCTCACTAACAGC
CCCATCTACGGCTTCACCCTATCGACGCTGGAGTTGGTTTCGGTGACGCAGGGCAAGGCCACGACCAGGCTGCGG
CTAACGGAGCGGCACGTCAACAGCAAGGGCGGCCTTCACGGCGCAGTGTCGGCCACCATTTTCGACTTGACGACG
GGGCTGGCCATCGCCTCATGGGACGGCCGCGAGACAACGGGCGCCAGTGTCGATATGCACCTGAGCTACCTGAGC
ACGGCGCGCGTGGGTGACGTGCTGCGTATCGAGACGACGGCTGAGAGGGTTGGTGGTAGCCTGGCGTTTGTGACG
GTTAGGATGCTGAAGGAGGGGGGCGAACGGGATGAGGTCGTTACGCTGGGACAGCATACCAAGTACGTCAAGGGG
ACTGCGGCCAGGGGAACGACGGAGGATGCCGCGGCGGTGCGACGCTAA
Transcript >Ophcf2|06999
ATGGCTCCGGACCTACCACAAGCAGCCAGGCTGCAGCACGTCGAGGCAGTCCTGCAGCGTCTCCTCACTAACAGC
CCCATCTACGGCTTCACCCTATCGACGCTGGAGTTGGTTTCGGTGACGCAGGGCAAGGCCACGACCAGGCTGCGG
CTAACGGAGCGGCACGTCAACAGCAAGGGCGGCCTTCACGGCGCAGTGTCGGCCACCATTTTCGACTTGACGACG
GGGCTGGCCATCGCCTCATGGGACGGCCGCGAGACAACGGGCGCCAGTGTCGATATGCACCTGAGCTACCTGAGC
ACGGCGCGCGTGGGTGACGTGCTGCGTATCGAGACGACGGCTGAGAGGGTTGGTGGTAGCCTGGCGTTTGTGACG
GTTAGGATGCTGAAGGAGGGGGGCGAACGGGATGAGGTCGTTACGCTGGGACAGCATACCAAGTACGTCAAGGGG
ACTGCGGCCAGGGGAACGACGGAGGATGCCGCGGCGGTGCGACGCTAA
Gene >Ophcf2|06999
ATGGCTCCGGACCTACCACAAGCAGCCAGGCTGCAGCACGTCGAGGCAGTCCTGCAGCGTCTCCTCACTAACAGC
CCCATCTACGGCTTCACCCTATCGACGCTGGAGTTGGTTTCGGTGACGCAGGGCAAGGCCACGACCAGGCTGCGG
CTAACGGAGCGGCACGTCAACAGCAAGGGCGGCCTTCACGGCGCAGTGTCGGCCACCATTTTCGACTTGACGACG
GGGCTGGCCATCGCCTCATGGGACGGCCGCGAGACAACGGGCGCCAGTGTCGATATGCACCTGAGCTACCTGAGC
ACGGCGCGCGTGGGTGACGTGCTGCGTATCGAGACGACGGCTGAGAGGGTTGGTGGTAGCCTGGCGTTTGTGACG
GTTAGGATGCTGAAGGAGGGGGGCGAACGGGATGAGGTCGTTACGCTGGGACAGCATACCAAGTACGTCAAGGGG
ACTGCGGCCAGGGGAACGACGGAGGATGCCGCGGCGGTGCGACGCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail