Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06987
Gene name
Locationscaffold_09:292513..294507
Strand-
Gene length (bp)1994
Transcript length (bp)795
Coding sequence length (bp)795
Protein length (aa) 265

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

Domain # Start End Length
1 73 95 22
2 100 120 20
3 135 157 22
4 164 186 22
5 216 238 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 14.64 5.15 24.13
Alive In ants, during behavior modification 12.40 4.07 20.74
Dead In ants, recently dead 11.65 3.78 19.52

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.614600 no
Alive Dead 0.845093 no
Dead Fungus 0.469127 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06987
MTILAPSLLALLLDQRVVRSSAILGFNYSHSAVSLCRKLLLQICRPSLLQDHRSTRFVASESSGPRASRLYQPSF
LFSMGVFTPPPIIALAYVGVRLFQIFLLLTPIVGLLAFFTDTTLSRFGFIDIRLLPEGVAIIFITSIVALGWCIL
TIIALFVANLDGKFIAIIDLGIMGALIGGVVRLRFIQFSCLVRRFFRTALTDLAFRLCVSVKASWILAIIAVIMF
FISAVLALAASLLRQPFRFGGKRRRRAVDSGGVHVHVDT*
Coding >Ophcf2|06987
ATGACGATTCTCGCTCCCTCCTTACTCGCGTTGCTGCTGGATCAGCGCGTAGTCCGAAGTTCTGCGATTCTCGGC
TTCAATTACTCGCACTCGGCCGTATCACTCTGCCGGAAACTATTGCTTCAGATTTGCCGTCCTTCTCTGCTTCAG
GACCATCGTTCAACCCGCTTCGTTGCGTCGGAATCAAGCGGTCCTCGGGCTTCGCGCCTCTATCAACCCTCCTTT
TTGTTCTCCATGGGTGTCTTTACTCCCCCCCCCATCATTGCCCTGGCGTACGTCGGCGTACGCTTGTTTCAAATA
TTTCTCCTCCTGACGCCCATCGTCGGCCTTCTCGCCTTCTTCACCGACACCACCTTGTCTCGATTCGGCTTCATC
GACATCAGGCTACTGCCAGAAGGAGTGGCCATCATCTTCATCACCTCCATCGTCGCCCTCGGATGGTGCATCCTC
ACCATCATCGCCCTATTCGTCGCCAATCTCGACGGCAAGTTTATAGCCATCATCGACTTGGGCATCATGGGCGCC
CTCATCGGAGGCGTCGTCCGTCTGCGCTTCATCCAGTTCTCCTGTCTCGTTCGTCGATTCTTCCGCACGGCGTTG
ACGGACTTGGCCTTTCGACTGTGCGTCTCCGTCAAAGCCAGCTGGATTCTCGCCATTATCGCCGTCATCATGTTC
TTCATATCGGCCGTGTTGGCTCTCGCTGCTTCTCTGCTTAGACAGCCCTTTCGCTTTGGCGGTAAGAGGAGGAGG
AGAGCGGTGGACAGTGGGGGGGTGCACGTTCACGTTGATACTTGA
Transcript >Ophcf2|06987
ATGACGATTCTCGCTCCCTCCTTACTCGCGTTGCTGCTGGATCAGCGCGTAGTCCGAAGTTCTGCGATTCTCGGC
TTCAATTACTCGCACTCGGCCGTATCACTCTGCCGGAAACTATTGCTTCAGATTTGCCGTCCTTCTCTGCTTCAG
GACCATCGTTCAACCCGCTTCGTTGCGTCGGAATCAAGCGGTCCTCGGGCTTCGCGCCTCTATCAACCCTCCTTT
TTGTTCTCCATGGGTGTCTTTACTCCCCCCCCCATCATTGCCCTGGCGTACGTCGGCGTACGCTTGTTTCAAATA
TTTCTCCTCCTGACGCCCATCGTCGGCCTTCTCGCCTTCTTCACCGACACCACCTTGTCTCGATTCGGCTTCATC
GACATCAGGCTACTGCCAGAAGGAGTGGCCATCATCTTCATCACCTCCATCGTCGCCCTCGGATGGTGCATCCTC
ACCATCATCGCCCTATTCGTCGCCAATCTCGACGGCAAGTTTATAGCCATCATCGACTTGGGCATCATGGGCGCC
CTCATCGGAGGCGTCGTCCGTCTGCGCTTCATCCAGTTCTCCTGTCTCGTTCGTCGATTCTTCCGCACGGCGTTG
ACGGACTTGGCCTTTCGACTGTGCGTCTCCGTCAAAGCCAGCTGGATTCTCGCCATTATCGCCGTCATCATGTTC
TTCATATCGGCCGTGTTGGCTCTCGCTGCTTCTCTGCTTAGACAGCCCTTTCGCTTTGGCGGTAAGAGGAGGAGG
AGAGCGGTGGACAGTGGGGGGGTGCACGTTCACGTTGATACTTGA
Gene >Ophcf2|06987
ATGACGATTCTCGCTCCCTCCTTACTCGCGTTGCTGCTGGATCAGCGCGTAGTCCGAAGTGTATGACTTGTCTTT
GGGCTTTTACGCCCTGCTTCCTCATATAGAAAGATGCTCTTATTTGATAGCCTAGTCTGCGATTCTCGGCTTCAA
TTACTCGCACTCGGCCGTATCACTCTGCCGGAAACTATTGCTTCGTACGAGATGCATGACTAGCCATTGCCCGCC
ACTTCACATTTGATCGAAAGAACTCTACCAGTTCAGCAGCAACCTCCAAAGATATCGACAACTCCCAACACTAAA
TCCCCGTCCTTTTACAACTCACGGTTCCTCAACACACAAACTCTCTCCCGCTCCCTCAAAAAAGACTCCTTCATC
ATCCCTCGTCGCGGCAACGTCCGAGCACAACCTCGCCGAAACCCGCTGCTTCACCCTCCGCGTTTCACCTGCCAT
CACCCGTCTCCCGAAGCACCTGCTAGCGTCGACCACCACTGTCCGGGGCTAGTTCCGAGATGAAGATCACGTCAC
CTCGCTGAAAGCCGATAGCAAAGGATGAGACGGAAAGAGAAAGCTGGTCGTCATCTTGTTCTGCTGTCAAGGGGT
AGGCCATTCTGCATTGTCTGCTCGAAACTACGTGTCAGACCCTTTCCTCTCTCCCCGTCATAGGTCGTCTTGACA
TCCGACGCTTCGTTCCTCTGTCGAGACGCCAGCCATGCGCCACGAGCCTTGTCTGCCGGACGTTTACCTCGGTCG
TCTCCGGATCGTCTCCTCAAACCATGTCTGTACGGCGTCTGCCCGTGACTCAATGCGACGCCCATCAGATTTTCC
CGGCTGGCTGGCTCATGGGCGGTAGGCAATAAGCTTATTCGAACGATCCGAGCCTTAGCTTGGTCGGATGGGGGT
AGCGGATTTGGGATGACACTCGAGACCACGAGTAAGGAAACTCGAGTAAGGCCAGCTCCCTAAACAGCGTCATTT
TTCATCTTGATCTTCTGTTACCACTCGTGACGGTCTGATTCAAGGGCTTGGCTCCCCTGTTCGTGTCCGTCCCGA
CTAGTCTCAGCGTGAACTTACTCGCTCGTTGCTCATATAGATGGTATCCGTCTGGGGGGTTTGTCTTATTCTTGA
GACTAAGAGACTCAGCATCATCGTATATATAGAGATTTGCCGTCCTTCTCTGCTTCAGGACCATCGTTCAACCCG
CTTCGTTGCGTCGGAATCAAGGTCAATTCCTATTCTCTGACATGACTTGGCCACGCGACACTGACACTTATTAAC
AGCGGTCCTCGGGCTTCGCGCCTCTATCAACCCTCCTTTTTGTTCTCGTCGGTCCTTGACGGAATCCTGCAGCAA
CACTTTAGACCGTTCTCTCGAATAGCATGGGTGTCTTTACTCCCCCCCCCATCATTGCCCTGGCGTACGTCGGCG
TACGCTTGTTTCAAATATTTCTCCTCCTGGTCAGTCATCCCTTTACCTCTTTTTTGGCTTCGACGGTGCTGATGG
TCTTCTCATAGACGCCCATCGTCGGCCTTCTCGCCTTCTTCACCGACACCACCTTGTCTCGATTCGGCTTCATCG
ACATCAGGCTACTGCCAGAAGGAGTGGCCATCATCTTCATCACCTCCATCGTCGCCCTCGGATGGTGCATCCTCA
CCATCATCGCCCTATTCGTCGCCAATCTCGACGGCAAGTTTATAGCCATCATCGACTTGGGCATCATGGGCGCCC
TCATCGGAGGCGTCGTCCGTCTGCGCTTCATCCAGTTCTCCTGTCTCGTTCGTCGATTCTTCCGCACGGCGTTGA
CGGACTTGGCCTTTCGACTGTGCGTCTCCGTCAAAGCCAGCTGGATTCTCGCCATTATCGCCGTCATCATGTTCT
TCATATCGGCCGTGTTGGCTCTCGCTGCTTCTCTGCTTAGACAGCCCTTTCGCTTTGGCGGTAAGAGGAGGAGGA
GAGCGGTGGACAGTGGGGGGGTGCACGTTCACGTTGATACTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail