Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06985
Gene name
Locationscaffold_09:287808..288923
Strand+
Gene length (bp)1115
Transcript length (bp)966
Coding sequence length (bp)966
Protein length (aa) 322

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.1537 0.0826 0.9441 0.1301 0.0561 0.0266 0.2199 0.1767 0.232 0.0029

SignalP

SignalP signal predicted Location Score
Yes 1 - 19 0.99978

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup6910
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|06985 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|06986
Ophiocordyceps camponoti-rufipedis Ophun1|7264
Ophiocordyceps kimflemingae Ophio5|5709

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06985
MHYPFLLAALAVLQPGTHGLPITEDEEQLYCEPSVSSVQDAEASVQSDGTNIGLTGPQASLLVTNGAKSAGLSPD
VVQNLALAAGKGIGSADEFVKVVGAVSVSAAGSASRKTSSIVRAMGAIEGLVLANMGDSSASHNVVAAAVAAASS
GEDQEVVTKITENTAKAAMKHENDANLIMTEASRGCRTKTCQVSVETVIRLISSGFGVKTALTVCVAVNTAAKYV
IELESYATALVEQSAHLERGVEPGEAARKMVEATRSLGNATQAADDVEKTTLEVAREIEKLPSPDIRFENYIYKC
LTDGFYIGFDNCNSTHGLDNE*
Coding >Ophcf2|06985
ATGCACTACCCCTTCCTGCTCGCCGCTCTGGCGGTGCTACAGCCCGGAACTCACGGCTTGCCCATCACGGAAGAC
GAGGAGCAACTCTACTGCGAGCCAAGCGTTTCTTCTGTCCAAGACGCCGAAGCCAGCGTACAGTCTGACGGGACC
AATATCGGGCTGACAGGCCCTCAAGCCTCCCTCCTCGTCACCAACGGTGCCAAGAGCGCCGGACTCAGCCCGGAC
GTTGTACAAAATCTAGCTCTGGCGGCCGGCAAGGGCATCGGATCCGCTGATGAGTTCGTCAAAGTCGTTGGCGCC
GTCAGCGTCTCAGCCGCCGGCTCGGCATCCCGGAAGACGTCTTCGATCGTCAGAGCTATGGGGGCTATCGAGGGC
CTTGTGCTCGCCAATATGGGAGACTCGTCTGCTTCTCACAACGTCGTGGCCGCAGCTGTTGCAGCCGCGTCGTCG
GGCGAGGATCAGGAGGTTGTGACCAAGATAACCGAGAACACAGCCAAGGCAGCGATGAAGCACGAAAACGACGCA
AATCTCATCATGACTGAAGCTTCGCGAGGCTGTCGAACCAAGACATGTCAGGTCAGCGTCGAGACAGTCATCCGG
CTCATCAGCAGCGGCTTCGGCGTCAAGACGGCACTTACGGTATGCGTGGCCGTCAACACGGCTGCCAAGTACGTC
ATCGAGCTCGAATCCTACGCCACAGCCCTCGTTGAGCAATCGGCGCACTTGGAAAGGGGAGTTGAGCCTGGTGAA
GCTGCGCGGAAGATGGTGGAGGCGACGAGGAGTCTTGGAAACGCGACGCAGGCTGCTGATGACGTGGAGAAGACG
ACTCTTGAGGTTGCGAGAGAGATTGAGAAGTTGCCGTCGCCTGACATTCGTTTCGAAAACTACATCTACAAGTGC
CTCACAGACGGATTCTATATCGGCTTCGACAACTGCAACTCCACTCACGGCCTCGACAACGAATGA
Transcript >Ophcf2|06985
ATGCACTACCCCTTCCTGCTCGCCGCTCTGGCGGTGCTACAGCCCGGAACTCACGGCTTGCCCATCACGGAAGAC
GAGGAGCAACTCTACTGCGAGCCAAGCGTTTCTTCTGTCCAAGACGCCGAAGCCAGCGTACAGTCTGACGGGACC
AATATCGGGCTGACAGGCCCTCAAGCCTCCCTCCTCGTCACCAACGGTGCCAAGAGCGCCGGACTCAGCCCGGAC
GTTGTACAAAATCTAGCTCTGGCGGCCGGCAAGGGCATCGGATCCGCTGATGAGTTCGTCAAAGTCGTTGGCGCC
GTCAGCGTCTCAGCCGCCGGCTCGGCATCCCGGAAGACGTCTTCGATCGTCAGAGCTATGGGGGCTATCGAGGGC
CTTGTGCTCGCCAATATGGGAGACTCGTCTGCTTCTCACAACGTCGTGGCCGCAGCTGTTGCAGCCGCGTCGTCG
GGCGAGGATCAGGAGGTTGTGACCAAGATAACCGAGAACACAGCCAAGGCAGCGATGAAGCACGAAAACGACGCA
AATCTCATCATGACTGAAGCTTCGCGAGGCTGTCGAACCAAGACATGTCAGGTCAGCGTCGAGACAGTCATCCGG
CTCATCAGCAGCGGCTTCGGCGTCAAGACGGCACTTACGGTATGCGTGGCCGTCAACACGGCTGCCAAGTACGTC
ATCGAGCTCGAATCCTACGCCACAGCCCTCGTTGAGCAATCGGCGCACTTGGAAAGGGGAGTTGAGCCTGGTGAA
GCTGCGCGGAAGATGGTGGAGGCGACGAGGAGTCTTGGAAACGCGACGCAGGCTGCTGATGACGTGGAGAAGACG
ACTCTTGAGGTTGCGAGAGAGATTGAGAAGTTGCCGTCGCCTGACATTCGTTTCGAAAACTACATCTACAAGTGC
CTCACAGACGGATTCTATATCGGCTTCGACAACTGCAACTCCACTCACGGCCTCGACAACGAATGA
Gene >Ophcf2|06985
ATGCACTACCCCTTCCTGCTCGCCGCTCTGGCGGTGCTACAGCCCGGAACTCACGGCTTGCCCATCACGGAAGAC
GAGGAGCAACTCTACTGCGAGCCAAGCGTTTCTTCTGTCCAAGACGCCGAAGCCAGCGTACAGTCTGACGGGACC
AATATCGGGCTGACAGGCCCTCAAGCCTCCCTCCTCGTCACCAACGGTGCCAAGAGCGCCGGACTCAGCCCGGAC
GTTGTACAAAATCTAGCTCTGGCGGCCGGCAAGGGCATCGGATCCGCTGATGAGTTCGTCAAAGTCGTTGGCGCC
GTCAGCGTCTCAGCCGCCGGCTCGGCATCCCGGAAGACGTCTTCGATCGTCAGAGCTATGGGGGCTATCGAGGGC
CTTGTGCTCGCCAATATGGGAGACTCGTCTGCTTCTCACAACGTCGTGGCCGCAGCTGTTGCAGCCGCGTCGTCG
GGCGAGGATCAGGAGGTTGTGACCAAGATAACCGAGAACACAGCCAAGGCAGCGATGAAGCACGAAAACGACGCA
AATCTCATCATGACTGAAGCTTCGCGAGGCTGTCGAACCAAGACATGTCAGGTCAGCGTCGAGACAGTCATCCGG
CTCATCAGCAGCGGCTTCGGCGTCAAGACGGCACTTACGGTATGCGTGGCCGTCAACACGGCTGCCAAGTACGTC
ATCGAGCTCGAATCCTACGCCACAGCCCTCGTTGAGCAATCGGCGCACTTGGAAAGGGGAGTTGAGCCTGGTGAA
GCTGCGCGGAAGATGGTGGAGGCGACGAGGAGTCTTGGAAACGCGACGCAGGCTGCTGATGACGTGGAGAAGACG
ACTCTTGAGGTTGCGAGAGAGATTGAGAAGTTGCCGTCGCCTGACATGTCCGTGTTGGCTGATGTAGCGGCTAAA
GATGGCCATCAGAGCAGTGAAAAGGCCACGGCTTCTGAAGTGGCGGGGATGTCTCCTACACTTATCGACGCTGGA
GAAGAAGGCCGAAGCTCCATCTCACAAGTTGCGGAATCGTCCACAGTCGTTTCGAAAACTACATCTACAAGTGCC
TCACAGACGGATTCTATATCGGCTTCGACAACTGCAACTCCACTCACGGCCTCGACAACGAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail