Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06983
Gene name
Locationscaffold_09:262946..264381
Strand+
Gene length (bp)1435
Transcript length (bp)1377
Coding sequence length (bp)1377
Protein length (aa) 459

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01933 CofD 2-phospho-L-lactate transferase CofD 3.4E-65 8 393

GO

GO Term Description Terminal node
GO:0043743 LPPG:FO 2-phospho-L-lactate transferase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0016740 transferase activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6751 0.3542 0.0336 0.134 0.1738 0.0061 0.1411 0.1212 0.0844 0.0344

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2395
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2682
Ophiocordyceps australis map64 (Brazil) OphauB2|3999
Ophiocordyceps camponoti-floridani Ophcf2|06983 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|7262
Ophiocordyceps kimflemingae Ophio5|7249
Ophiocordyceps subramaniannii Hirsu2|3382

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06983
MAPQPLGIVVFSGGSATNSLVDVFEHVRQTSGSSLSYVMPISDNGGSTSEIIRVFGGPGIGDSRSRLVRLIPDTG
DAETLAIKRLFNHRLPAAADDARAEWFDVLEARHSLWTAISSPKRELIRSHLNNFHLEAVRRMRPGSRFSFSKAS
LGNLFLTGARLFTGSFEAAIYLLAAICALPERVAVLPAIETNFAHHIAAGLRDGTVITGQNDISHPCPVQGGHGD
DDDDDDHHHHHHHHDGVEDANLPGSLPALRRPAIDFCKDGDDHLPARIDRVWYINPYGHEIHIPANPRVLDALAT
ADTVVYSIGSLYTSLVPNLVLRGIGDAITNTRIRNKILILNGTNDRETGPLSDPFTALDFVAAIADACADSRGVG
RLARDEYSRYVTHVLYLQCSGAPEVDRQRLASLGIDSTRLYGPRDEQGKAGRYDGKALTQALESIVGRKNTSLDR
SRRNTLVG*
Coding >Ophcf2|06983
ATGGCACCGCAGCCGCTCGGCATCGTCGTCTTCTCCGGCGGCAGCGCAACCAATAGCCTCGTCGACGTCTTCGAG
CACGTGCGACAGACAAGCGGCAGCTCGCTCAGCTACGTCATGCCCATCTCCGACAACGGAGGCAGCACGAGCGAG
ATCATCCGCGTCTTCGGAGGGCCCGGCATCGGTGACTCGAGGTCACGACTCGTGCGCCTCATCCCCGACACCGGC
GACGCCGAGACGCTGGCCATCAAACGACTGTTCAACCACCGACTCCCCGCCGCCGCCGACGATGCCCGTGCCGAA
TGGTTCGACGTGCTCGAGGCTCGTCACTCGCTGTGGACGGCCATTTCTTCGCCAAAGCGCGAGCTCATACGCTCT
CACCTCAACAACTTCCACCTCGAGGCCGTCCGCCGTATGAGACCCGGCAGTCGCTTCAGCTTCTCCAAGGCCAGT
CTCGGCAACTTGTTCCTGACGGGCGCTCGTCTCTTCACCGGCAGCTTCGAGGCCGCCATTTATCTGCTGGCCGCC
ATCTGCGCCCTCCCCGAACGAGTGGCAGTCCTACCAGCCATCGAGACCAACTTTGCCCATCACATCGCCGCCGGT
CTGCGAGACGGCACCGTCATCACGGGCCAGAACGACATCTCCCATCCCTGTCCCGTCCAGGGAGGTCATGGCGAC
GACGACGACGACGACGACCACCACCACCACCACCACCACCACGATGGAGTTGAAGACGCCAACCTCCCGGGCTCG
CTCCCGGCTCTCCGTCGACCGGCCATAGATTTCTGCAAAGACGGCGACGACCATCTGCCTGCGCGCATCGACCGC
GTCTGGTATATCAACCCGTACGGCCACGAGATTCACATCCCCGCCAATCCGAGGGTGCTAGACGCTCTTGCGACT
GCCGACACCGTCGTCTACAGCATCGGCTCGCTCTACACGTCGCTCGTTCCCAATCTGGTGCTCCGGGGCATCGGC
GACGCCATAACAAATACCCGCATCCGCAACAAGATCCTCATCCTCAACGGCACAAACGATCGCGAGACGGGGCCT
TTGAGCGATCCCTTTACCGCCCTCGACTTCGTCGCCGCCATCGCCGACGCCTGCGCCGACTCGAGAGGAGTGGGA
CGGCTCGCCCGAGACGAGTACTCGCGCTACGTCACCCATGTTCTCTACCTGCAGTGCTCCGGCGCACCAGAGGTC
GACAGGCAGCGACTCGCCAGCCTCGGCATAGACTCGACCCGTCTATATGGGCCCAGGGATGAGCAAGGCAAGGCG
GGGCGATACGACGGCAAGGCTCTGACGCAGGCTCTCGAGTCCATCGTCGGCCGTAAGAATACGAGCCTGGACAGG
AGTCGTCGCAACACTCTGGTGGGATAG
Transcript >Ophcf2|06983
ATGGCACCGCAGCCGCTCGGCATCGTCGTCTTCTCCGGCGGCAGCGCAACCAATAGCCTCGTCGACGTCTTCGAG
CACGTGCGACAGACAAGCGGCAGCTCGCTCAGCTACGTCATGCCCATCTCCGACAACGGAGGCAGCACGAGCGAG
ATCATCCGCGTCTTCGGAGGGCCCGGCATCGGTGACTCGAGGTCACGACTCGTGCGCCTCATCCCCGACACCGGC
GACGCCGAGACGCTGGCCATCAAACGACTGTTCAACCACCGACTCCCCGCCGCCGCCGACGATGCCCGTGCCGAA
TGGTTCGACGTGCTCGAGGCTCGTCACTCGCTGTGGACGGCCATTTCTTCGCCAAAGCGCGAGCTCATACGCTCT
CACCTCAACAACTTCCACCTCGAGGCCGTCCGCCGTATGAGACCCGGCAGTCGCTTCAGCTTCTCCAAGGCCAGT
CTCGGCAACTTGTTCCTGACGGGCGCTCGTCTCTTCACCGGCAGCTTCGAGGCCGCCATTTATCTGCTGGCCGCC
ATCTGCGCCCTCCCCGAACGAGTGGCAGTCCTACCAGCCATCGAGACCAACTTTGCCCATCACATCGCCGCCGGT
CTGCGAGACGGCACCGTCATCACGGGCCAGAACGACATCTCCCATCCCTGTCCCGTCCAGGGAGGTCATGGCGAC
GACGACGACGACGACGACCACCACCACCACCACCACCACCACGATGGAGTTGAAGACGCCAACCTCCCGGGCTCG
CTCCCGGCTCTCCGTCGACCGGCCATAGATTTCTGCAAAGACGGCGACGACCATCTGCCTGCGCGCATCGACCGC
GTCTGGTATATCAACCCGTACGGCCACGAGATTCACATCCCCGCCAATCCGAGGGTGCTAGACGCTCTTGCGACT
GCCGACACCGTCGTCTACAGCATCGGCTCGCTCTACACGTCGCTCGTTCCCAATCTGGTGCTCCGGGGCATCGGC
GACGCCATAACAAATACCCGCATCCGCAACAAGATCCTCATCCTCAACGGCACAAACGATCGCGAGACGGGGCCT
TTGAGCGATCCCTTTACCGCCCTCGACTTCGTCGCCGCCATCGCCGACGCCTGCGCCGACTCGAGAGGAGTGGGA
CGGCTCGCCCGAGACGAGTACTCGCGCTACGTCACCCATGTTCTCTACCTGCAGTGCTCCGGCGCACCAGAGGTC
GACAGGCAGCGACTCGCCAGCCTCGGCATAGACTCGACCCGTCTATATGGGCCCAGGGATGAGCAAGGCAAGGCG
GGGCGATACGACGGCAAGGCTCTGACGCAGGCTCTCGAGTCCATCGTCGGCCGTAAGAATACGAGCCTGGACAGG
AGTCGTCGCAACACTCTGGTGGGATAG
Gene >Ophcf2|06983
ATGGCACCGCAGCCGCTCGGCATCGTCGTCTTCTCCGGCGGCAGCGCAACCAATAGCCTCGTCGACGTCTTCGAG
CACGTGCGACAGACAAGCGGCAGCTCGCTCAGCTACGTCATGCCCATCTCCGACAACGGAGGCAGCACGAGCGAG
ATCATCCGCGTCTTCGGAGGGCCCGGTACGTTGCTACCGCCGCCTCGGACGACGGCTGACGACCGGGAACTGAGA
GCATCAAGGCATCGGTGACTCGAGGTCACGACTCGTGCGCCTCATCCCCGACACCGGCGACGCCGAGACGCTGGC
CATCAAACGACTGTTCAACCACCGACTCCCCGCCGCCGCCGACGATGCCCGTGCCGAATGGTTCGACGTGCTCGA
GGCTCGTCACTCGCTGTGGACGGCCATTTCTTCGCCAAAGCGCGAGCTCATACGCTCTCACCTCAACAACTTCCA
CCTCGAGGCCGTCCGCCGTATGAGACCCGGCAGTCGCTTCAGCTTCTCCAAGGCCAGTCTCGGCAACTTGTTCCT
GACGGGCGCTCGTCTCTTCACCGGCAGCTTCGAGGCCGCCATTTATCTGCTGGCCGCCATCTGCGCCCTCCCCGA
ACGAGTGGCAGTCCTACCAGCCATCGAGACCAACTTTGCCCATCACATCGCCGCCGGTCTGCGAGACGGCACCGT
CATCACGGGCCAGAACGACATCTCCCATCCCTGTCCCGTCCAGGGAGGTCATGGCGACGACGACGACGACGACGA
CCACCACCACCACCACCACCACCACGATGGAGTTGAAGACGCCAACCTCCCGGGCTCGCTCCCGGCTCTCCGTCG
ACCGGCCATAGATTTCTGCAAAGACGGCGACGACCATCTGCCTGCGCGCATCGACCGCGTCTGGTATATCAACCC
GTACGGCCACGAGATTCACATCCCCGCCAATCCGAGGGTGCTAGACGCTCTTGCGACTGCCGACACCGTCGTCTA
CAGCATCGGCTCGCTCTACACGTCGCTCGTTCCCAATCTGGTGCTCCGGGGCATCGGCGACGCCATAACAAATAC
CCGCATCCGCAACAAGATCCTCATCCTCAACGGCACAAACGATCGCGAGACGGGGCCTTTGAGCGATCCCTTTAC
CGCCCTCGACTTCGTCGCCGCCATCGCCGACGCCTGCGCCGACTCGAGAGGAGTGGGACGGCTCGCCCGAGACGA
GTACTCGCGCTACGTCACCCATGTTCTCTACCTGCAGTGCTCCGGCGCACCAGAGGTCGACAGGCAGCGACTCGC
CAGCCTCGGCATAGACTCGACCCGTCTATATGGGCCCAGGGATGAGCAAGGCAAGGCGGGGCGATACGACGGCAA
GGCTCTGACGCAGGCTCTCGAGTCCATCGTCGGCCGTAAGAATACGAGCCTGGACAGGAGTCGTCGCAACACTCT
GGTGGGATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail