Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06982
Gene name
Locationscaffold_09:245606..246083
Strand+
Gene length (bp)477
Transcript length (bp)417
Coding sequence length (bp)417
Protein length (aa) 139

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.0675 0.0302 0.9229 0.069 0.0633 0.0055 0.1041 0.1819 0.0631 0.0038

SignalP

SignalP signal predicted Location Score
Yes 1 - 18 0.999504

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2396
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2684
Ophiocordyceps australis map64 (Brazil) OphauB2|3997
Ophiocordyceps camponoti-floridani Ophcf2|06982 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|7261
Ophiocordyceps kimflemingae Ophio5|7250
Ophiocordyceps subramaniannii Hirsu2|3384

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06982
MLISSIATALVLAASCLAHPKIRRKQTDLRLFSGDNCTKGNLGVWTVVEGDLFPGECKMFPVTVGSVGIESIYDG
CTVTLYVDDECKPVVTMTEKKLHTGDQAIVEGCVISRTGMSFKAFTVSCDFQKKMDEWDFQHH*
Coding >Ophcf2|06982
ATGTTGATCTCGTCCATCGCAACGGCCCTTGTCCTGGCCGCCAGCTGCCTCGCCCACCCCAAGATCCGCAGGAAA
CAGACCGACTTACGTCTCTTCAGCGGCGACAATTGCACAAAGGGCAATCTCGGCGTCTGGACCGTCGTCGAGGGC
GACCTTTTCCCTGGCGAGTGCAAGATGTTCCCGGTCACCGTCGGGTCCGTTGGCATCGAGAGCATATACGATGGC
TGCACGGTCACGTTGTACGTCGACGACGAATGCAAGCCGGTCGTGACAATGACGGAAAAGAAGCTTCATACGGGA
GACCAGGCGATAGTAGAGGGATGCGTCATCTCTCGTACGGGCATGTCTTTCAAGGCCTTTACCGTGAGCTGCGAC
TTTCAGAAGAAGATGGATGAATGGGACTTTCAACATCATTGA
Transcript >Ophcf2|06982
ATGTTGATCTCGTCCATCGCAACGGCCCTTGTCCTGGCCGCCAGCTGCCTCGCCCACCCCAAGATCCGCAGGAAA
CAGACCGACTTACGTCTCTTCAGCGGCGACAATTGCACAAAGGGCAATCTCGGCGTCTGGACCGTCGTCGAGGGC
GACCTTTTCCCTGGCGAGTGCAAGATGTTCCCGGTCACCGTCGGGTCCGTTGGCATCGAGAGCATATACGATGGC
TGCACGGTCACGTTGTACGTCGACGACGAATGCAAGCCGGTCGTGACAATGACGGAAAAGAAGCTTCATACGGGA
GACCAGGCGATAGTAGAGGGATGCGTCATCTCTCGTACGGGCATGTCTTTCAAGGCCTTTACCGTGAGCTGCGAC
TTTCAGAAGAAGATGGATGAATGGGACTTTCAACATCATTGA
Gene >Ophcf2|06982
ATGTTGATCTCGTCCATCGCAACGGCCCTTGTCCTGGCCGCCAGCTGCCTCGCCCACCCCAAGATCCGCAGGAAA
CAGACCGACTTACGTCTCTTCAGCGGCGACAATTGCACAAAGGGCAATCTCGGCGTCTGGACCGTCGTCGAGGGC
GACCTTTTCCCTGGCGAGTGCAAGATGTTCCCGGTCACCGTCGGGTCCGTTGGCATCGAGAGCATATACGATGGC
TGCACGGGTGAGTCTGCTACCGAGTCTTCCACGCTGACAGATGGTGGGCTAATGCGTGCTCCCGCAGTCACGTTG
TACGTCGACGACGAATGCAAGCCGGTCGTGACAATGACGGAAAAGAAGCTTCATACGGGAGACCAGGCGATAGTA
GAGGGATGCGTCATCTCTCGTACGGGCATGTCTTTCAAGGCCTTTACCGTGAGCTGCGACTTTCAGAAGAAGATG
GATGAATGGGACTTTCAACATCATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail