Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06978
Gene name
Locationscaffold_09:213225..215008
Strand+
Gene length (bp)1783
Transcript length (bp)1479
Coding sequence length (bp)1479
Protein length (aa) 493

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01222 ERG4_ERG24 Ergosterol biosynthesis ERG4/ERG24 family 1.8E-166 21 492

GO

GO Term Description Terminal node
GO:0016628 oxidoreductase activity, acting on the CH-CH group of donors, NAD or NADP as acceptor Yes
GO:0016020 membrane Yes
GO:0016126 sterol biosynthetic process Yes
GO:1901360 organic cyclic compound metabolic process No
GO:0110165 cellular anatomical entity No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0008152 metabolic process No
GO:0006694 steroid biosynthetic process No
GO:0009058 biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0016491 oxidoreductase activity No
GO:0008202 steroid metabolic process No
GO:0003824 catalytic activity No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0005575 cellular_component No
GO:0006629 lipid metabolic process No
GO:0003674 molecular_function No
GO:0008610 lipid biosynthetic process No
GO:1901615 organic hydroxy compound metabolic process No
GO:0016627 oxidoreductase activity, acting on the CH-CH group of donors No
GO:0016125 sterol metabolic process No
GO:0008150 biological_process No
GO:1901617 organic hydroxy compound biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.5

Transmembrane Domains

Domain # Start End Length
1 21 43 22
2 86 108 22
3 128 150 22
4 165 187 22
5 257 276 19
6 296 315 19
7 327 346 19
8 440 459 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06978
MKHHERTSLSITMAPNSVAEHGYEFFGPPGAFGISFGLPLLVYAFTFACNDVSGCPAPALLRPSTLSSDQLKLQV
GWPEDGVWGLASWKATGALLAYYALNLVLYRVLPAAQTEGTVLASGGRLKYRLNTMYSNTMTLAVLAAGTVAQGA
DFSVWRFIDENYVQLLTASIGISYAMSTFVYVRSFGVKPGNKDGRELAAGGHSGNMLYDWFIGRELNPRVVVPLI
GEVDIKEWCELRPGMMGWIVLNCAWCVRQYRNYGYVTDSILCITAVQAVYTVDSWWNEAAILTTMDITTDGFGMM
LAFGDLVWVPFVYSLQTRYLSVHPRSLGPAGLVAMLSLIGLGFFIFRSANSQKNVFRTNPEDPSVSNLEYIETKT
GSRLLTTGWWGVARHINYLGDWIQAWPYSLPTGLAGYQVLAAGTGSEGAYVMMDGREVVAGEAKGWGMVVTYFYI
VYFAVLLIHRDRRDDEKCQRKYGEDWTKYKKLVRWRIVPGLY*
Coding >Ophcf2|06978
ATGAAGCATCACGAGAGAACATCGCTCTCCATCACAATGGCGCCCAACTCAGTTGCAGAGCACGGCTACGAATTC
TTCGGACCCCCCGGGGCCTTCGGCATCTCCTTCGGTCTGCCCCTTCTCGTTTACGCCTTTACCTTTGCCTGCAAC
GATGTCTCAGGCTGTCCGGCGCCCGCGTTGCTCCGCCCGTCGACGTTGTCTTCGGACCAGTTGAAGCTTCAGGTT
GGCTGGCCCGAGGATGGCGTTTGGGGTCTGGCCAGCTGGAAGGCGACGGGCGCCTTACTGGCTTATTACGCCCTC
AACCTCGTCCTGTACCGCGTGCTGCCTGCCGCTCAAACCGAGGGTACCGTTCTGGCCTCGGGTGGGCGACTCAAG
TATAGGCTCAACACCATGTATTCCAACACGATGACTCTCGCCGTGCTCGCCGCGGGCACCGTTGCTCAAGGCGCC
GACTTTTCCGTCTGGCGCTTCATCGACGAGAACTACGTGCAGCTGCTGACGGCGAGCATCGGCATCTCGTATGCC
ATGTCCACCTTTGTCTACGTCCGGAGCTTCGGCGTCAAGCCCGGCAACAAAGATGGCCGCGAGCTGGCAGCGGGC
GGACACAGCGGCAACATGCTGTACGACTGGTTCATCGGACGGGAGCTTAATCCCAGAGTCGTCGTGCCGCTCATC
GGCGAGGTGGACATCAAGGAGTGGTGCGAGCTGCGACCGGGTATGATGGGCTGGATCGTGCTCAACTGCGCCTGG
TGCGTCCGTCAGTATCGCAACTATGGTTACGTGACGGATAGTATCTTGTGCATCACCGCCGTTCAGGCCGTTTAC
ACGGTCGATTCGTGGTGGAACGAGGCGGCCATTCTGACGACCATGGACATTACCACCGACGGCTTCGGCATGATG
CTGGCGTTTGGCGACCTGGTATGGGTGCCCTTTGTCTACTCGCTACAGACGCGCTACCTCTCGGTGCATCCGCGC
TCGCTAGGACCCGCGGGCTTGGTGGCGATGCTCAGCCTCATCGGCCTTGGCTTCTTCATCTTCCGGTCGGCCAAC
AGCCAGAAGAACGTGTTTAGGACGAACCCCGAGGACCCCAGCGTCTCCAACCTCGAATACATCGAGACCAAGACA
GGCAGCCGGCTGCTGACGACGGGCTGGTGGGGGGTGGCGCGGCACATCAACTACCTGGGCGACTGGATCCAGGCG
TGGCCGTACAGCTTGCCGACGGGCCTGGCCGGGTACCAGGTGCTGGCGGCCGGGACGGGCTCCGAGGGCGCGTAC
GTGATGATGGATGGCCGCGAGGTGGTGGCCGGCGAAGCCAAGGGCTGGGGCATGGTGGTGACGTACTTTTACATT
GTCTACTTTGCCGTGCTGCTGATCCATCGCGACCGACGCGACGACGAAAAGTGCCAGCGCAAGTACGGCGAGGAT
TGGACCAAGTACAAGAAGCTTGTGCGATGGCGCATCGTCCCGGGCCTATACTGA
Transcript >Ophcf2|06978
ATGAAGCATCACGAGAGAACATCGCTCTCCATCACAATGGCGCCCAACTCAGTTGCAGAGCACGGCTACGAATTC
TTCGGACCCCCCGGGGCCTTCGGCATCTCCTTCGGTCTGCCCCTTCTCGTTTACGCCTTTACCTTTGCCTGCAAC
GATGTCTCAGGCTGTCCGGCGCCCGCGTTGCTCCGCCCGTCGACGTTGTCTTCGGACCAGTTGAAGCTTCAGGTT
GGCTGGCCCGAGGATGGCGTTTGGGGTCTGGCCAGCTGGAAGGCGACGGGCGCCTTACTGGCTTATTACGCCCTC
AACCTCGTCCTGTACCGCGTGCTGCCTGCCGCTCAAACCGAGGGTACCGTTCTGGCCTCGGGTGGGCGACTCAAG
TATAGGCTCAACACCATGTATTCCAACACGATGACTCTCGCCGTGCTCGCCGCGGGCACCGTTGCTCAAGGCGCC
GACTTTTCCGTCTGGCGCTTCATCGACGAGAACTACGTGCAGCTGCTGACGGCGAGCATCGGCATCTCGTATGCC
ATGTCCACCTTTGTCTACGTCCGGAGCTTCGGCGTCAAGCCCGGCAACAAAGATGGCCGCGAGCTGGCAGCGGGC
GGACACAGCGGCAACATGCTGTACGACTGGTTCATCGGACGGGAGCTTAATCCCAGAGTCGTCGTGCCGCTCATC
GGCGAGGTGGACATCAAGGAGTGGTGCGAGCTGCGACCGGGTATGATGGGCTGGATCGTGCTCAACTGCGCCTGG
TGCGTCCGTCAGTATCGCAACTATGGTTACGTGACGGATAGTATCTTGTGCATCACCGCCGTTCAGGCCGTTTAC
ACGGTCGATTCGTGGTGGAACGAGGCGGCCATTCTGACGACCATGGACATTACCACCGACGGCTTCGGCATGATG
CTGGCGTTTGGCGACCTGGTATGGGTGCCCTTTGTCTACTCGCTACAGACGCGCTACCTCTCGGTGCATCCGCGC
TCGCTAGGACCCGCGGGCTTGGTGGCGATGCTCAGCCTCATCGGCCTTGGCTTCTTCATCTTCCGGTCGGCCAAC
AGCCAGAAGAACGTGTTTAGGACGAACCCCGAGGACCCCAGCGTCTCCAACCTCGAATACATCGAGACCAAGACA
GGCAGCCGGCTGCTGACGACGGGCTGGTGGGGGGTGGCGCGGCACATCAACTACCTGGGCGACTGGATCCAGGCG
TGGCCGTACAGCTTGCCGACGGGCCTGGCCGGGTACCAGGTGCTGGCGGCCGGGACGGGCTCCGAGGGCGCGTAC
GTGATGATGGATGGCCGCGAGGTGGTGGCCGGCGAAGCCAAGGGCTGGGGCATGGTGGTGACGTACTTTTACATT
GTCTACTTTGCCGTGCTGCTGATCCATCGCGACCGACGCGACGACGAAAAGTGCCAGCGCAAGTACGGCGAGGAT
TGGACCAAGTACAAGAAGCTTGTGCGATGGCGCATCGTCCCGGGCCTATACTGA
Gene >Ophcf2|06978
ATGAAGCATCACGAGTTGGATACCTCGATAAACCCAGAGGCGCAGCGTGGCGTTATTCTATAATCTACGAATACA
TCAATCGTACATACCTAGGTAGATAAGCTCCGTCATATCGTCGAAAGGAGAACATCGCTGTAAGCAATATCGTTA
TACCCATCTACAAAGACTGATCATCTCATCTCGAAACCCGACCTGATTTTTTCCCTCGCACAAGCTCCATCACAA
TGGCGCCCAACTCAGTTGCAGAGCACGGCTACGAATTCTTCGGACCGTACGTCGCCCCGCTCCCGCCGACCGGCC
TCCGTCCGCGCTGACTTTCCGCCGCTGCAGCCCCGGGGCCTTCGGCATCTCCTTCGGTCTGCCCCTTCTCGTTTA
CGCCTTTACCTTTGCCTGCAACGATGTCTCAGGCTGTCCGGCGCCCGCGTTGCTCCGCCCGTCGACGTTGTCTTC
GGACCAGTTGAAGCTTCAGGTTGGCTGGCCCGAGGATGGCGTTTGGGGTCTGGCCAGCTGGAAGGCGACGGGCGC
CTTACTGGCTTATTACGCCCTCAACCTCGTCCTGTACCGCGTGCTGCCTGCCGCTCAAACCGAGGGTACCGTTCT
GGCCTCGGGTGGGCGACTCAAGTATAGGCTCAACAGTGAGTGACGTGGTCGAGCTCCGGAGTAGCATCGTGCTGA
TGATTCGGGGGTCGCAGCCATGTATTCCAACACGATGACTCTCGCCGTGCTCGCCGCGGGCACCGTTGCTCAAGG
CGCCGACTTTTCCGTCTGGCGCTTCATCGACGAGAACTACGTGCAGCTGCTGACGGCGAGCATCGGCATCTCGTA
TGCCATGTCCACCTTTGTCTACGTCCGGAGCTTCGGCGTCAAGCCCGGCAACAAAGATGGCCGCGAGCTGGCAGC
GGGCGGACACAGCGGCAACATGCTGTACGACTGGTTCATCGGACGGGAGCTTAATCCCAGAGTCGTCGTGCCGCT
CATCGGCGAGGTGGACATCAAGGAGTGGTGCGAGCTGCGACCGGGTATGATGGGCTGGATCGTGCTCAACTGCGC
CTGGTGCGTCCGTCAGTATCGCAACTATGGTTACGTGACGGATAGTATCTTGTGCATCACCGCCGTTCAGGCCGT
TTACACGGTCGATTCGTGGTGGAACGAGGCGGCCATTCTGACGACCATGGACATTACCACCGACGGCTTCGGCAT
GATGCTGGCGTTTGGCGACCTGGTATGGGTGCCCTTTGTCTACTCGCTACAGACGCGCTACCTCTCGGTGCATCC
GCGCTCGCTAGGACCCGCGGGCTTGGTGGCGATGCTCAGCCTCATCGGCCTTGGCTTCTTCATCTTCCGGTCGGC
CAACAGCCAGAAGAACGTGTTTAGGACGAACCCCGAGGACCCCAGCGTCTCCAACCTCGAATACATCGAGACCAA
GACAGGCAGCCGGCTGCTGACGACGGGCTGGTGGGGGGTGGCGCGGCACATCAACTACCTGGGCGACTGGATCCA
GGCGTGGCCGTACAGCTTGCCGACGGGCCTGGCCGGGTACCAGGTGCTGGCGGCCGGGACGGGCTCCGAGGGCGC
GTACGTGATGATGGATGGCCGCGAGGTGGTGGCCGGCGAAGCCAAGGGCTGGGGCATGGTGGTGACGTACTTTTA
CATTGTCTACTTTGCCGTGCTGCTGATCCATCGCGACCGACGCGACGACGAAAAGTGCCAGCGCAAGTACGGCGA
GGATTGGACCAAGTACAAGAAGCTTGTGCGATGGCGCATCGTCCCGGGCCTATACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail