Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06977
Gene name
Locationscaffold_09:211559..212660
Strand-
Gene length (bp)1101
Transcript length (bp)966
Coding sequence length (bp)966
Protein length (aa) 322

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02157 Man-6-P_recep Mannose-6-phosphate receptor 3.4E-14 156 271
PF09451 ATG27 Autophagy-related protein 27 8.7E-13 33 272
PF00878 CIMR Cation-independent mannose-6-phosphate receptor repeat 8.8E-05 166 213

GO

GO Term Description Terminal node
GO:0038023 signaling receptor activity Yes
GO:0005537 mannose binding Yes
GO:0007041 lysosomal transport Yes
GO:0051234 establishment of localization No
GO:0060089 molecular transducer activity No
GO:0005488 binding No
GO:0036094 small molecule binding No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0006810 transport No
GO:0051649 establishment of localization in cell No
GO:0008150 biological_process No
GO:0048029 monosaccharide binding No
GO:0007034 vacuolar transport No
GO:0046907 intracellular transport No
GO:0030246 carbohydrate binding No
GO:0051641 cellular localization No
GO:0051179 localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

Domain # Start End Length
1 222 244 22
2 259 281 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06977
MRRLRISVALLAGAVAAAVAGEAASSSTTTTAPACTATSSTGSGAFFDLRPDLAGPPNKAKDYHAKGYDYGSNFT
LNICGAVVEPVKDVVGIDKELWANVSAFYTTHGNVYSIGSQSLDLRSRGRKLVLQYAGGSPCGPKATKDGRDQHS
IDKAAKKTDDKTSERRKSTTISFLCDKDPGSTQASVSFVGADADECAYFFEARSIHACAHAEPHKPGSVGPGSVF
GIILLIAVLVYVLGGVFYNRTVTNARGWRQLPNYSLWAGIGGFVSDLFLAAWSWCCRYVPARRGGYSYLNSNASS
RHRSSDAENRLIDQLDEEWED*
Coding >Ophcf2|06977
ATGCGCCGCCTCCGAATCTCCGTTGCCCTTCTGGCCGGCGCCGTCGCGGCGGCCGTCGCTGGCGAAGCTGCCTCT
TCCTCGACGACGACGACGGCTCCCGCCTGCACCGCTACATCATCTACCGGCAGCGGCGCCTTCTTCGACCTGCGC
CCAGACCTGGCCGGCCCGCCCAACAAGGCCAAGGACTACCACGCCAAGGGATACGACTACGGGAGTAATTTCACC
CTCAACATCTGCGGCGCCGTCGTTGAACCCGTCAAGGACGTCGTCGGCATCGACAAGGAACTCTGGGCCAACGTC
AGCGCCTTCTACACGACCCACGGCAACGTCTACTCCATCGGATCACAGTCGTTGGACTTGAGGAGTCGAGGGCGC
AAACTCGTACTGCAGTATGCCGGCGGATCGCCCTGCGGGCCCAAGGCAACCAAAGACGGCCGAGATCAGCATAGT
ATCGACAAGGCCGCGAAAAAGACGGATGACAAGACGTCTGAAAGGCGAAAGTCGACGACGATCTCTTTCCTCTGC
GATAAAGACCCTGGAAGCACGCAGGCCAGCGTCTCTTTCGTGGGTGCCGATGCCGACGAGTGCGCCTACTTCTTC
GAAGCCCGCTCTATTCACGCCTGCGCACACGCCGAGCCTCACAAGCCCGGAAGCGTCGGCCCGGGCAGCGTCTTT
GGCATCATTCTCCTCATCGCAGTCCTCGTCTACGTCCTCGGCGGCGTCTTCTACAACCGTACTGTGACGAATGCT
CGCGGCTGGCGTCAGCTGCCCAACTACAGCCTCTGGGCCGGCATCGGCGGATTCGTTAGCGACTTGTTTCTCGCC
GCTTGGTCCTGGTGCTGTCGCTACGTGCCGGCTCGAAGAGGAGGCTACAGCTATCTGAATTCGAACGCGAGCAGT
CGACACCGAAGCTCGGATGCGGAAAATCGGCTGATCGATCAGCTGGACGAAGAATGGGAAGACTGA
Transcript >Ophcf2|06977
ATGCGCCGCCTCCGAATCTCCGTTGCCCTTCTGGCCGGCGCCGTCGCGGCGGCCGTCGCTGGCGAAGCTGCCTCT
TCCTCGACGACGACGACGGCTCCCGCCTGCACCGCTACATCATCTACCGGCAGCGGCGCCTTCTTCGACCTGCGC
CCAGACCTGGCCGGCCCGCCCAACAAGGCCAAGGACTACCACGCCAAGGGATACGACTACGGGAGTAATTTCACC
CTCAACATCTGCGGCGCCGTCGTTGAACCCGTCAAGGACGTCGTCGGCATCGACAAGGAACTCTGGGCCAACGTC
AGCGCCTTCTACACGACCCACGGCAACGTCTACTCCATCGGATCACAGTCGTTGGACTTGAGGAGTCGAGGGCGC
AAACTCGTACTGCAGTATGCCGGCGGATCGCCCTGCGGGCCCAAGGCAACCAAAGACGGCCGAGATCAGCATAGT
ATCGACAAGGCCGCGAAAAAGACGGATGACAAGACGTCTGAAAGGCGAAAGTCGACGACGATCTCTTTCCTCTGC
GATAAAGACCCTGGAAGCACGCAGGCCAGCGTCTCTTTCGTGGGTGCCGATGCCGACGAGTGCGCCTACTTCTTC
GAAGCCCGCTCTATTCACGCCTGCGCACACGCCGAGCCTCACAAGCCCGGAAGCGTCGGCCCGGGCAGCGTCTTT
GGCATCATTCTCCTCATCGCAGTCCTCGTCTACGTCCTCGGCGGCGTCTTCTACAACCGTACTGTGACGAATGCT
CGCGGCTGGCGTCAGCTGCCCAACTACAGCCTCTGGGCCGGCATCGGCGGATTCGTTAGCGACTTGTTTCTCGCC
GCTTGGTCCTGGTGCTGTCGCTACGTGCCGGCTCGAAGAGGAGGCTACAGCTATCTGAATTCGAACGCGAGCAGT
CGACACCGAAGCTCGGATGCGGAAAATCGGCTGATCGATCAGCTGGACGAAGAATGGGAAGACTGA
Gene >Ophcf2|06977
ATGCGCCGCCTCCGAATCTCCGTTGCCCTTCTGGCCGGCGCCGTCGCGGCGGCCGTCGCTGGCGAAGCTGCCTCT
TCCTCGACGACGACGACGGCTCCCGCCTGCACCGCTACATCATCTACCGGCAGCGGCGCCTTCTTCGACCTGCGC
CCAGACCTGGCCGGCCCGCCCAACAAGGCCAAGGACTACCACGCCAAGGGATACGACTACGGGAGTAATTTCACC
CTCAACATCTGCGGCGCCGTCGTTGAACCCGTCAAGGACGTCGTCGGCATCGACAAGGAACTCTGGGCCAACGTC
AGCGCCTTCTACACGACCCACGGCAACGTCTACTCCATCGGGTGCGACGCCGGCCCTTCTATTTCCACAGTCTGG
ATGGCCCTCTCGCTGACACGAAGCCGCGCAGATCACAGTCGTTGGACTTGAGGAGTCGAGGGCGCAAACTCGTAC
TGCAGTATGCCGGCGGATCGCCCTGCGGGCCCAAGGCAACCAAAGACGGCCGAGATCAGCATAGTATCGACAAGG
CCGCGAAAAAGACGGATGACAAGACGTCTGAAAGGCGAAAGTCGACGACGATCTCTTTCCTCTGCGATAAAGACC
CTGGAAGCACGCAGGCCAGCGTCTCTTTCGTGGGTGCCGATGCCGACGAGTGCGCCTACTTCTTCGAAGCCCGCT
CTATTCACGCCTGCGCACACGCCGAGCCTCACAAGCCCGGAAGCGTCGGCCCGGGCAGCGTCTTTGGCATCATTC
TCCTCATCGCAGTCCTCGTCTACGTCCTCGGCGGCGTCTTCTACAACCGTACTGTGACGAATGCTCGCGGCTGGC
GTCAGCTGCCCAACTACAGCCTCTGGGCCGGCATCGGCGGATTCGTTAGCGTGCGTCCCTCGCGGCGGGAGCCGG
GTCTTCTCCTCTACCGACGAAGAGCGAGCTGACATGGGCTTGTAGGACTTGTTTCTCGCCGCTTGGTCCTGGTGC
TGTCGCTACGTGCCGGCTCGAAGAGGAGGCTACAGCTATCTGAATTCGAACGCGAGCAGTCGACACCGAAGCTCG
GATGCGGAAAATCGGCTGATCGATCAGCTGGACGAAGAATGGGAAGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail