Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06970
Gene name
Locationscaffold_09:165074..166055
Strand+
Gene length (bp)981
Transcript length (bp)918
Coding sequence length (bp)918
Protein length (aa) 306

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF19327 Ap4A_phos_N Ap4A phosphorylase N-terminal domain 1.8E-28 34 161
PF09830 ATP_transf ATP adenylyltransferase C-terminal domain 1.7E-20 188 301

GO

GO Term Description Terminal node
GO:0003877 ATP adenylyltransferase activity Yes
GO:0070566 adenylyltransferase activity No
GO:0016779 nucleotidyltransferase activity No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0016740 transferase activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Peroxisomal targeting signal 0.5104 0.6991 0.0317 0.015 0.4166 0.0218 0.0462 0.0617 0.0705 0.4452

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup6833
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2691
Ophiocordyceps australis map64 (Brazil) OphauB2|3989
Ophiocordyceps camponoti-floridani Ophcf2|06970 (this protein)
Ophiocordyceps kimflemingae Ophio5|7797

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06970
MSRAIKAPQGLPELVDFTFRNCRAGQDVIHHSSTVGLFQAGPIPFQIRFCPALAKKPKPVKESSRPVDPFASPPE
RLCLGDVGPGHYLVLNKFPVLDGHFILATKQFEPQGSLLDVGDLEAALACVKAYEHIDGGLFVFFNSGEHSGASQ
PHRHLQMLPMKSMRLDQDGDEKMTSWEPLITLPSLLESAPFVTFSQDIKPDSSPGKVRASYLSLYRRACNSLGID
AEEQTEGEARISYNLGLTAERLVVCPRRAEGDEMGMLSLNGTVLAGTALVKSEEAWRALAEGPELLEGVLRKIGV
ERGRS*
Coding >Ophcf2|06970
ATGTCCCGCGCCATAAAGGCCCCCCAAGGCTTGCCAGAGCTGGTAGACTTCACATTCCGCAACTGTCGTGCCGGC
CAAGACGTCATTCACCACTCTTCGACAGTCGGCCTGTTCCAAGCGGGCCCCATCCCGTTTCAAATTCGCTTCTGT
CCTGCTCTCGCCAAAAAGCCCAAACCGGTCAAAGAGTCATCTAGGCCGGTTGACCCGTTCGCTAGCCCGCCTGAG
CGTCTGTGTCTGGGGGACGTTGGGCCGGGCCATTACCTCGTGCTCAACAAGTTTCCTGTCCTGGATGGGCACTTT
ATCCTCGCGACTAAGCAGTTTGAACCGCAAGGGTCGCTGCTAGACGTTGGTGATCTTGAGGCTGCGTTGGCTTGT
GTCAAGGCTTATGAGCATATCGACGGGGGCCTGTTCGTCTTCTTCAATAGCGGTGAGCATTCGGGCGCCAGTCAG
CCTCATCGTCATCTTCAGATGCTACCGATGAAGTCCATGCGTTTGGATCAAGACGGCGATGAAAAGATGACATCA
TGGGAGCCTCTCATAACGCTTCCTTCTCTCCTCGAATCCGCGCCCTTCGTCACCTTTTCCCAAGACATTAAACCA
GACTCATCGCCTGGAAAAGTCCGCGCGTCGTATTTGAGTCTCTACAGAAGGGCCTGCAACTCGCTGGGCATCGAC
GCAGAAGAACAGACGGAGGGCGAAGCGCGCATCAGCTACAACCTGGGGCTGACGGCTGAGCGGCTGGTCGTGTGT
CCGCGGCGGGCTGAGGGCGATGAGATGGGTATGTTGTCACTTAACGGGACCGTCCTGGCTGGTACGGCGCTGGTG
AAGAGCGAGGAGGCTTGGAGGGCTTTGGCTGAGGGTCCGGAGTTGCTGGAGGGAGTGTTGCGCAAGATTGGCGTG
GAAAGGGGGAGGAGTTGA
Transcript >Ophcf2|06970
ATGTCCCGCGCCATAAAGGCCCCCCAAGGCTTGCCAGAGCTGGTAGACTTCACATTCCGCAACTGTCGTGCCGGC
CAAGACGTCATTCACCACTCTTCGACAGTCGGCCTGTTCCAAGCGGGCCCCATCCCGTTTCAAATTCGCTTCTGT
CCTGCTCTCGCCAAAAAGCCCAAACCGGTCAAAGAGTCATCTAGGCCGGTTGACCCGTTCGCTAGCCCGCCTGAG
CGTCTGTGTCTGGGGGACGTTGGGCCGGGCCATTACCTCGTGCTCAACAAGTTTCCTGTCCTGGATGGGCACTTT
ATCCTCGCGACTAAGCAGTTTGAACCGCAAGGGTCGCTGCTAGACGTTGGTGATCTTGAGGCTGCGTTGGCTTGT
GTCAAGGCTTATGAGCATATCGACGGGGGCCTGTTCGTCTTCTTCAATAGCGGTGAGCATTCGGGCGCCAGTCAG
CCTCATCGTCATCTTCAGATGCTACCGATGAAGTCCATGCGTTTGGATCAAGACGGCGATGAAAAGATGACATCA
TGGGAGCCTCTCATAACGCTTCCTTCTCTCCTCGAATCCGCGCCCTTCGTCACCTTTTCCCAAGACATTAAACCA
GACTCATCGCCTGGAAAAGTCCGCGCGTCGTATTTGAGTCTCTACAGAAGGGCCTGCAACTCGCTGGGCATCGAC
GCAGAAGAACAGACGGAGGGCGAAGCGCGCATCAGCTACAACCTGGGGCTGACGGCTGAGCGGCTGGTCGTGTGT
CCGCGGCGGGCTGAGGGCGATGAGATGGGTATGTTGTCACTTAACGGGACCGTCCTGGCTGGTACGGCGCTGGTG
AAGAGCGAGGAGGCTTGGAGGGCTTTGGCTGAGGGTCCGGAGTTGCTGGAGGGAGTGTTGCGCAAGATTGGCGTG
GAAAGGGGGAGGAGTTGA
Gene >Ophcf2|06970
ATGTCCCGCGCCATAAAGGCCCCCCAAGGCTTGCCAGAGCTGGTAGACTTCACATTCCGCAACTGTCGTGCCGGC
CAAGACGTCATTCACCACTCTTCGACAGTCGGCCTGTTCCAAGCGGGCCCCATCCCGGTATGTCAACAGCCGGAA
ACGACCTCACGCCGTCTCCCGGACTGACGACCTCCGACCTGTCAGTTTCAAATTCGCTTCTGTCCTGCTCTCGCC
AAAAAGCCCAAACCGGTCAAAGAGTCATCTAGGCCGGTTGACCCGTTCGCTAGCCCGCCTGAGCGTCTGTGTCTG
GGGGACGTTGGGCCGGGCCATTACCTCGTGCTCAACAAGTTTCCTGTCCTGGATGGGCACTTTATCCTCGCGACT
AAGCAGTTTGAACCGCAAGGGTCGCTGCTAGACGTTGGTGATCTTGAGGCTGCGTTGGCTTGTGTCAAGGCTTAT
GAGCATATCGACGGGGGCCTGTTCGTCTTCTTCAATAGCGGTGAGCATTCGGGCGCCAGTCAGCCTCATCGTCAT
CTTCAGATGCTACCGATGAAGTCCATGCGTTTGGATCAAGACGGCGATGAAAAGATGACATCATGGGAGCCTCTC
ATAACGCTTCCTTCTCTCCTCGAATCCGCGCCCTTCGTCACCTTTTCCCAAGACATTAAACCAGACTCATCGCCT
GGAAAAGTCCGCGCGTCGTATTTGAGTCTCTACAGAAGGGCCTGCAACTCGCTGGGCATCGACGCAGAAGAACAG
ACGGAGGGCGAAGCGCGCATCAGCTACAACCTGGGGCTGACGGCTGAGCGGCTGGTCGTGTGTCCGCGGCGGGCT
GAGGGCGATGAGATGGGTATGTTGTCACTTAACGGGACCGTCCTGGCTGGTACGGCGCTGGTGAAGAGCGAGGAG
GCTTGGAGGGCTTTGGCTGAGGGTCCGGAGTTGCTGGAGGGAGTGTTGCGCAAGATTGGCGTGGAAAGGGGGAGG
AGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail