Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06969
Gene name
Locationscaffold_09:163715..164667
Strand+
Gene length (bp)952
Transcript length (bp)894
Coding sequence length (bp)894
Protein length (aa) 298

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10261 Scs3p Inositol phospholipid synthesis and fat-storage-inducing TM 4.3E-69 69 279

GO

GO Term Description Terminal node
GO:0005789 endoplasmic reticulum membrane Yes
GO:0019915 lipid storage Yes
GO:0005575 cellular_component No
GO:0051179 localization No
GO:0031090 organelle membrane No
GO:0016020 membrane No
GO:0008150 biological_process No
GO:0110165 cellular anatomical entity No
GO:0051235 maintenance of location No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 52 0.5

Transmembrane Domains

Domain # Start End Length
1 27 46 19
2 82 104 22
3 119 141 22
4 240 262 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06969
MAPSPRAGGGIAAPRHSPYLPTPLERLTVSIFPLILTFGAIFSLLSPETRSAPYYAGEQAHAQTAEEAPSYFARK
ANVFNVVFVKRGWAWTTFSFFFFVVTRGATDKRRLQAGFRWVGATAWWVLVTQWCFGPPLIDRGFLWTGGKCEDR
KDDMFTAVACKAAGGRWRGGHDISGHVFLLVLGSLFLGQEVGWPLLRAAHLRAEERCVVMADGAIKGAGVESDGE
QASTEQGLGPAAKTTMVVVGMKLWMLLMTAIYFHTWFEKFSGLMTALVGGYGLYIVPRFVPGLRAVVGLPGI*
Coding >Ophcf2|06969
ATGGCACCGTCACCGCGCGCCGGCGGAGGCATAGCAGCCCCAAGGCACTCCCCCTATCTCCCGACACCGCTCGAA
AGGCTGACCGTCTCCATCTTTCCCTTGATCCTCACCTTCGGCGCCATCTTCTCGCTACTCTCTCCTGAGACTCGC
TCAGCTCCATACTACGCCGGCGAGCAGGCGCACGCGCAGACAGCCGAAGAAGCTCCTAGTTACTTCGCCCGCAAA
GCCAATGTCTTCAACGTCGTCTTCGTCAAGCGCGGCTGGGCCTGGACCACCTTTTCTTTCTTCTTCTTCGTCGTC
ACGAGGGGAGCCACCGATAAGCGCAGGTTGCAGGCGGGTTTTCGCTGGGTAGGGGCTACGGCGTGGTGGGTGCTC
GTTACGCAGTGGTGTTTCGGACCGCCTCTCATTGACCGTGGCTTTCTGTGGACTGGAGGCAAGTGTGAAGATCGC
AAGGATGACATGTTTACCGCTGTGGCTTGCAAGGCGGCGGGGGGGAGATGGCGAGGCGGGCATGATATATCTGGG
CATGTCTTTCTGCTGGTTCTCGGCTCGCTGTTTCTCGGACAGGAGGTTGGCTGGCCGCTTTTGCGGGCTGCTCAT
CTGAGAGCGGAGGAGAGGTGTGTCGTCATGGCGGACGGGGCCATCAAGGGCGCAGGCGTCGAGTCGGATGGAGAA
CAAGCATCGACGGAGCAGGGGCTTGGACCGGCGGCCAAGACGACCATGGTGGTCGTTGGCATGAAGCTGTGGATG
CTGCTGATGACGGCCATTTACTTTCACACCTGGTTCGAAAAGTTTTCCGGACTAATGACGGCGCTGGTGGGAGGA
TACGGGCTGTATATTGTGCCGCGCTTCGTGCCTGGTTTGAGGGCCGTTGTAGGACTGCCGGGGATATGA
Transcript >Ophcf2|06969
ATGGCACCGTCACCGCGCGCCGGCGGAGGCATAGCAGCCCCAAGGCACTCCCCCTATCTCCCGACACCGCTCGAA
AGGCTGACCGTCTCCATCTTTCCCTTGATCCTCACCTTCGGCGCCATCTTCTCGCTACTCTCTCCTGAGACTCGC
TCAGCTCCATACTACGCCGGCGAGCAGGCGCACGCGCAGACAGCCGAAGAAGCTCCTAGTTACTTCGCCCGCAAA
GCCAATGTCTTCAACGTCGTCTTCGTCAAGCGCGGCTGGGCCTGGACCACCTTTTCTTTCTTCTTCTTCGTCGTC
ACGAGGGGAGCCACCGATAAGCGCAGGTTGCAGGCGGGTTTTCGCTGGGTAGGGGCTACGGCGTGGTGGGTGCTC
GTTACGCAGTGGTGTTTCGGACCGCCTCTCATTGACCGTGGCTTTCTGTGGACTGGAGGCAAGTGTGAAGATCGC
AAGGATGACATGTTTACCGCTGTGGCTTGCAAGGCGGCGGGGGGGAGATGGCGAGGCGGGCATGATATATCTGGG
CATGTCTTTCTGCTGGTTCTCGGCTCGCTGTTTCTCGGACAGGAGGTTGGCTGGCCGCTTTTGCGGGCTGCTCAT
CTGAGAGCGGAGGAGAGGTGTGTCGTCATGGCGGACGGGGCCATCAAGGGCGCAGGCGTCGAGTCGGATGGAGAA
CAAGCATCGACGGAGCAGGGGCTTGGACCGGCGGCCAAGACGACCATGGTGGTCGTTGGCATGAAGCTGTGGATG
CTGCTGATGACGGCCATTTACTTTCACACCTGGTTCGAAAAGTTTTCCGGACTAATGACGGCGCTGGTGGGAGGA
TACGGGCTGTATATTGTGCCGCGCTTCGTGCCTGGTTTGAGGGCCGTTGTAGGACTGCCGGGGATATGA
Gene >Ophcf2|06969
ATGGCACCGTCACCGCGCGCCGGCGGAGGCATAGCAGCCCCAAGGCACTCCCCCTATCTCCCGACACCGCTCGAA
AGGCTGACCGTCTCCATCTTTCCCTTGATCCTCACCTTCGGCGCCATCTTCTCGCTACTCTCTCCTGAGACTCGC
TCAGCTCCATACTACGCCGGCGAGCAGGCGCACGCGCAGACAGCCGAAGAAGCTCCTAGTTACTTCGCCCGCAAA
GCCAATGTCTTCAACGTCGTCTTCGTCAAGCGCGGCTGGGCCTGGACCACCTTTTCTTTCTTCTTCTTCGTCGTC
ACGAGGGGAGCCACCGATAAGCGCAGGTTGCAGGCGGGTTTTCGCTGGGTAGGGGCTACGGCGTGGTGGGTGCTC
GTTACGCAGTGGTGTTTCGGACCGCCTCTCATTGACCGTGGCTTTCTGTGGACTGGAGGCAAGTGTGAAGATCGC
AAGGATGACATGTTTACCGCTGTGGCTTGCAAGGCGGCGGGGGGGAGATGGCGAGGCGGGCATGATATATCTGGG
CATGTCTTTCTGCTGGTTCTCGGCTCGCTGTTTCTCGGACAGGAGGTTGGCTGGCCGCTTTTGCGGGCTGCTCAT
CTGAGAGCGGAGGAGAGGTGTGTCGTCATGGCGGACGGGGCCATCAAGGGCGCAGGCGTCGAGTCGGATGGAGAA
CAAGCATCGACGGAGCAGGGGCTTGGACCGGCGGCCAAGACGACCATGGTGGTCGTTGGCATGAAGCTGTGGATG
CTGCTGATGACGGCCATTTACTTTCACACCTGGTTCGAAAAGGTACGCTTGCTACTCGTTGACGATGATCTGTCG
GGCTTTGGCTAACTTTTGGCGACAGTTTTCCGGACTAATGACGGCGCTGGTGGGAGGATACGGGCTGTATATTGT
GCCGCGCTTCGTGCCTGGTTTGAGGGCCGTTGTAGGACTGCCGGGGATATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail