Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06967
Gene name
Locationscaffold_09:158125..160021
Strand-
Gene length (bp)1896
Transcript length (bp)1842
Coding sequence length (bp)1842
Protein length (aa) 614

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01794 Ferric_reduct Ferric reductase like transmembrane component 1.9E-19 146 262
PF08022 FAD_binding_8 FAD-binding domain 3.4E-10 322 413
PF08030 NAD_binding_6 Ferric reductase NAD binding domain 2.7E-06 419 586

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.5

Transmembrane Domains

Domain # Start End Length
1 23 45 22
2 111 133 22
3 148 170 22
4 183 201 18
5 221 240 19
6 247 264 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06967
MDMSGHAHNHGGNAGLGFEINYTFARAFWFLVVAAVGLAVAVRIADYFVARQRLRACADPAFDHSVCARPTGPVS
QAWATATALAREAGLPQISPPAIPGLRWAAPPPLGRVLLLLIYWAVVIYLMSYNVVHYDVYYWERIGYRNAWISV
AQLPLIYLLATKCNPVGWLVGCGHERLNWLHRWVARTMLITATVHGFHFWTEWERADFVAYELAAMPLVKYGLGA
WGVLLWTVVVGFVPVRRLAYEVWLLQHIVSAIVMLWLLHRHIPANARYLLWMSVGFFVWDRVARGLLLLWRNVPW
SFTPQPSSVLQGLRQRRCGHDMTLRLLGEDVTVVTVRGVRFGWRPGQHVYLWVPRLGPLEAHPYTVAGARDPSGN
LQLVVRARGGFSRRLCDFAARHPDRILTAFVSGPFGVPPRWDIYETLVLMGASTGASFVLPLLESIAVAVPGHLC
ARRVELTLVARTAAEIDFYLFRAKDAARRARRRGIRVLLHVALTGQDAGQPLLQHQSLSEESAAKKTDGHFVDEP
SSSSPSGDGVDDDDGDYFICQYAGRPDVEALIREPVEEAWGEAAVMVCGGRELIARTRNCVSRLSDERAVHKGTG
AQGIYLHAEEYAF*
Coding >Ophcf2|06967
ATGGACATGTCGGGACATGCTCACAACCACGGCGGCAACGCTGGCCTCGGCTTTGAGATAAACTACACCTTTGCC
CGCGCTTTCTGGTTTCTTGTCGTTGCCGCCGTCGGTCTGGCCGTCGCCGTCCGCATAGCCGACTACTTCGTCGCC
CGCCAGAGACTTCGAGCCTGCGCCGACCCGGCCTTTGATCACTCAGTCTGCGCCCGGCCCACCGGCCCCGTGAGC
CAGGCTTGGGCCACGGCCACGGCGCTCGCCCGCGAGGCCGGCCTTCCTCAGATATCTCCCCCGGCCATACCCGGA
CTACGCTGGGCTGCCCCCCCGCCGCTGGGCCGCGTGCTTCTCCTGCTGATTTACTGGGCCGTCGTCATCTACCTG
ATGAGCTACAATGTCGTCCACTACGACGTCTACTACTGGGAACGCATCGGCTACCGCAACGCCTGGATCTCCGTC
GCCCAGCTGCCGCTCATCTATCTCCTGGCCACCAAGTGCAACCCGGTCGGCTGGTTGGTGGGATGCGGTCACGAG
CGCCTCAACTGGCTGCATCGCTGGGTGGCGCGCACTATGCTCATCACCGCCACCGTTCACGGCTTCCACTTCTGG
ACCGAGTGGGAGAGGGCCGACTTTGTCGCCTATGAGCTGGCCGCCATGCCTCTGGTCAAGTACGGCCTCGGAGCT
TGGGGCGTTCTACTGTGGACCGTTGTCGTCGGTTTCGTCCCCGTCCGTCGGCTTGCCTACGAGGTCTGGCTGCTT
CAGCACATTGTCTCGGCCATCGTCATGTTGTGGCTGCTGCATCGCCATATTCCCGCCAACGCCCGCTATCTGTTG
TGGATGTCCGTCGGCTTCTTTGTCTGGGACCGCGTCGCTCGCGGCCTGCTGCTGCTGTGGCGGAACGTACCATGG
TCGTTCACACCTCAGCCGTCATCGGTTCTTCAGGGGCTGCGTCAGCGACGTTGTGGACACGACATGACGCTGCGT
CTTCTCGGCGAAGACGTCACCGTCGTCACCGTCAGGGGCGTCCGCTTCGGCTGGCGGCCGGGCCAGCACGTCTAT
CTTTGGGTGCCGCGTCTCGGACCACTGGAGGCTCATCCCTACACCGTCGCCGGCGCTCGAGATCCCAGCGGCAAC
CTTCAACTCGTCGTCCGAGCTCGTGGCGGCTTCTCTCGACGTCTTTGCGACTTTGCCGCTCGTCACCCAGATCGC
ATCCTCACGGCCTTTGTTTCCGGCCCCTTTGGCGTCCCTCCGCGCTGGGATATATACGAGACGCTCGTCTTGATG
GGCGCTTCGACTGGAGCCAGCTTCGTTCTCCCCCTACTGGAGAGCATTGCTGTCGCCGTCCCCGGCCATTTGTGT
GCCCGACGCGTTGAGTTGACGCTCGTGGCCCGGACGGCAGCCGAGATCGACTTTTACTTGTTCCGGGCCAAGGAT
GCGGCCAGACGAGCGCGTCGACGGGGTATCCGAGTGCTGCTGCACGTGGCCCTGACGGGACAAGATGCCGGTCAG
CCGCTTCTCCAGCACCAGTCACTGAGCGAGGAGTCAGCGGCGAAAAAGACGGACGGTCACTTTGTCGACGAGCCT
TCAAGCAGCAGCCCGAGCGGTGACGGCGTTGACGACGACGATGGCGATTACTTCATCTGTCAGTACGCCGGCCGT
CCCGATGTCGAGGCCCTCATCCGGGAGCCCGTGGAGGAAGCCTGGGGCGAGGCAGCCGTGATGGTGTGCGGAGGT
CGCGAGCTGATTGCCCGAACGCGCAACTGCGTTAGCCGGCTGAGTGACGAGAGGGCGGTGCACAAGGGGACTGGG
GCTCAGGGCATATATCTGCACGCCGAGGAGTACGCCTTTTGA
Transcript >Ophcf2|06967
ATGGACATGTCGGGACATGCTCACAACCACGGCGGCAACGCTGGCCTCGGCTTTGAGATAAACTACACCTTTGCC
CGCGCTTTCTGGTTTCTTGTCGTTGCCGCCGTCGGTCTGGCCGTCGCCGTCCGCATAGCCGACTACTTCGTCGCC
CGCCAGAGACTTCGAGCCTGCGCCGACCCGGCCTTTGATCACTCAGTCTGCGCCCGGCCCACCGGCCCCGTGAGC
CAGGCTTGGGCCACGGCCACGGCGCTCGCCCGCGAGGCCGGCCTTCCTCAGATATCTCCCCCGGCCATACCCGGA
CTACGCTGGGCTGCCCCCCCGCCGCTGGGCCGCGTGCTTCTCCTGCTGATTTACTGGGCCGTCGTCATCTACCTG
ATGAGCTACAATGTCGTCCACTACGACGTCTACTACTGGGAACGCATCGGCTACCGCAACGCCTGGATCTCCGTC
GCCCAGCTGCCGCTCATCTATCTCCTGGCCACCAAGTGCAACCCGGTCGGCTGGTTGGTGGGATGCGGTCACGAG
CGCCTCAACTGGCTGCATCGCTGGGTGGCGCGCACTATGCTCATCACCGCCACCGTTCACGGCTTCCACTTCTGG
ACCGAGTGGGAGAGGGCCGACTTTGTCGCCTATGAGCTGGCCGCCATGCCTCTGGTCAAGTACGGCCTCGGAGCT
TGGGGCGTTCTACTGTGGACCGTTGTCGTCGGTTTCGTCCCCGTCCGTCGGCTTGCCTACGAGGTCTGGCTGCTT
CAGCACATTGTCTCGGCCATCGTCATGTTGTGGCTGCTGCATCGCCATATTCCCGCCAACGCCCGCTATCTGTTG
TGGATGTCCGTCGGCTTCTTTGTCTGGGACCGCGTCGCTCGCGGCCTGCTGCTGCTGTGGCGGAACGTACCATGG
TCGTTCACACCTCAGCCGTCATCGGTTCTTCAGGGGCTGCGTCAGCGACGTTGTGGACACGACATGACGCTGCGT
CTTCTCGGCGAAGACGTCACCGTCGTCACCGTCAGGGGCGTCCGCTTCGGCTGGCGGCCGGGCCAGCACGTCTAT
CTTTGGGTGCCGCGTCTCGGACCACTGGAGGCTCATCCCTACACCGTCGCCGGCGCTCGAGATCCCAGCGGCAAC
CTTCAACTCGTCGTCCGAGCTCGTGGCGGCTTCTCTCGACGTCTTTGCGACTTTGCCGCTCGTCACCCAGATCGC
ATCCTCACGGCCTTTGTTTCCGGCCCCTTTGGCGTCCCTCCGCGCTGGGATATATACGAGACGCTCGTCTTGATG
GGCGCTTCGACTGGAGCCAGCTTCGTTCTCCCCCTACTGGAGAGCATTGCTGTCGCCGTCCCCGGCCATTTGTGT
GCCCGACGCGTTGAGTTGACGCTCGTGGCCCGGACGGCAGCCGAGATCGACTTTTACTTGTTCCGGGCCAAGGAT
GCGGCCAGACGAGCGCGTCGACGGGGTATCCGAGTGCTGCTGCACGTGGCCCTGACGGGACAAGATGCCGGTCAG
CCGCTTCTCCAGCACCAGTCACTGAGCGAGGAGTCAGCGGCGAAAAAGACGGACGGTCACTTTGTCGACGAGCCT
TCAAGCAGCAGCCCGAGCGGTGACGGCGTTGACGACGACGATGGCGATTACTTCATCTGTCAGTACGCCGGCCGT
CCCGATGTCGAGGCCCTCATCCGGGAGCCCGTGGAGGAAGCCTGGGGCGAGGCAGCCGTGATGGTGTGCGGAGGT
CGCGAGCTGATTGCCCGAACGCGCAACTGCGTTAGCCGGCTGAGTGACGAGAGGGCGGTGCACAAGGGGACTGGG
GCTCAGGGCATATATCTGCACGCCGAGGAGTACGCCTTTTGA
Gene >Ophcf2|06967
ATGGACATGTCGGGACATGCTCACAACCACGGCGGCAACGCTGGCCTCGGCTTTGAGATAAACTACACCTTTGCC
CGCGCTTTCTGGTTTCTTGTCGTTGCCGCCGTCGGTCTGGCCGTCGCCGTCCGCATAGCCGACTACTTCGTCGCC
CGCCAGAGGTTCGTCTCGTCCGTCTCTGAGCCTCGTCGCCCTCTTGCTGACTATTTCGGCAGACTTCGAGCCTGC
GCCGACCCGGCCTTTGATCACTCAGTCTGCGCCCGGCCCACCGGCCCCGTGAGCCAGGCTTGGGCCACGGCCACG
GCGCTCGCCCGCGAGGCCGGCCTTCCTCAGATATCTCCCCCGGCCATACCCGGACTACGCTGGGCTGCCCCCCCG
CCGCTGGGCCGCGTGCTTCTCCTGCTGATTTACTGGGCCGTCGTCATCTACCTGATGAGCTACAATGTCGTCCAC
TACGACGTCTACTACTGGGAACGCATCGGCTACCGCAACGCCTGGATCTCCGTCGCCCAGCTGCCGCTCATCTAT
CTCCTGGCCACCAAGTGCAACCCGGTCGGCTGGTTGGTGGGATGCGGTCACGAGCGCCTCAACTGGCTGCATCGC
TGGGTGGCGCGCACTATGCTCATCACCGCCACCGTTCACGGCTTCCACTTCTGGACCGAGTGGGAGAGGGCCGAC
TTTGTCGCCTATGAGCTGGCCGCCATGCCTCTGGTCAAGTACGGCCTCGGAGCTTGGGGCGTTCTACTGTGGACC
GTTGTCGTCGGTTTCGTCCCCGTCCGTCGGCTTGCCTACGAGGTCTGGCTGCTTCAGCACATTGTCTCGGCCATC
GTCATGTTGTGGCTGCTGCATCGCCATATTCCCGCCAACGCCCGCTATCTGTTGTGGATGTCCGTCGGCTTCTTT
GTCTGGGACCGCGTCGCTCGCGGCCTGCTGCTGCTGTGGCGGAACGTACCATGGTCGTTCACACCTCAGCCGTCA
TCGGTTCTTCAGGGGCTGCGTCAGCGACGTTGTGGACACGACATGACGCTGCGTCTTCTCGGCGAAGACGTCACC
GTCGTCACCGTCAGGGGCGTCCGCTTCGGCTGGCGGCCGGGCCAGCACGTCTATCTTTGGGTGCCGCGTCTCGGA
CCACTGGAGGCTCATCCCTACACCGTCGCCGGCGCTCGAGATCCCAGCGGCAACCTTCAACTCGTCGTCCGAGCT
CGTGGCGGCTTCTCTCGACGTCTTTGCGACTTTGCCGCTCGTCACCCAGATCGCATCCTCACGGCCTTTGTTTCC
GGCCCCTTTGGCGTCCCTCCGCGCTGGGATATATACGAGACGCTCGTCTTGATGGGCGCTTCGACTGGAGCCAGC
TTCGTTCTCCCCCTACTGGAGAGCATTGCTGTCGCCGTCCCCGGCCATTTGTGTGCCCGACGCGTTGAGTTGACG
CTCGTGGCCCGGACGGCAGCCGAGATCGACTTTTACTTGTTCCGGGCCAAGGATGCGGCCAGACGAGCGCGTCGA
CGGGGTATCCGAGTGCTGCTGCACGTGGCCCTGACGGGACAAGATGCCGGTCAGCCGCTTCTCCAGCACCAGTCA
CTGAGCGAGGAGTCAGCGGCGAAAAAGACGGACGGTCACTTTGTCGACGAGCCTTCAAGCAGCAGCCCGAGCGGT
GACGGCGTTGACGACGACGATGGCGATTACTTCATCTGTCAGTACGCCGGCCGTCCCGATGTCGAGGCCCTCATC
CGGGAGCCCGTGGAGGAAGCCTGGGGCGAGGCAGCCGTGATGGTGTGCGGAGGTCGCGAGCTGATTGCCCGAACG
CGCAACTGCGTTAGCCGGCTGAGTGACGAGAGGGCGGTGCACAAGGGGACTGGGGCTCAGGGCATATATCTGCAC
GCCGAGGAGTACGCCTTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail