Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06963
Gene name
Locationscaffold_09:149579..152471
Strand-
Gene length (bp)2892
Transcript length (bp)2781
Coding sequence length (bp)2781
Protein length (aa) 927

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03169 OPT OPT oligopeptide transporter protein 2.3E-144 215 877

GO

GO Term Description Terminal node
GO:0035673 oligopeptide transmembrane transporter activity Yes
GO:1904680 peptide transmembrane transporter activity No
GO:0042887 amide transmembrane transporter activity No
GO:0022857 transmembrane transporter activity No
GO:0003674 molecular_function No
GO:0005215 transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

Domain # Start End Length
1 216 238 22
2 243 265 22
3 290 312 22
4 327 349 22
5 392 411 19
6 421 443 22
7 464 486 22
8 540 562 22
9 600 622 22
10 627 649 22
11 656 678 22
12 708 730 22
13 779 798 19
14 813 835 22
15 855 877 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06963
MASEQRDHNGGRDEDEKKDDKRRQSTCTIDQDEKQDSSSTKDTLTNGSEGSSSRPLSSSTLNEKIWTQPKDDKSS
EFDLTLKLEEPADLDLAFKLEKSSDSDSSLIQSTVKVEESSELQSQDSTETLSEEALDAQLKDLIIKHEFDQNFP
TELLSRARAFTQGTNGARSEAEISAGHEAIKSFREFDELVRNSSPYMEVRSVVDVTDDPSVPVGTFRVFVLGTFF
TALGSGISQFFSLRLPSIEISTFVIQLLAMPLGIAMARWIPKDKHVGFRGWTVNLNPGEFTQKEHLLVAMMGNTL
TSPYIVSIVQVLKLDLFYGEKVLSSSILWQVLTLVSSQLLGYGCAGLTRRFLIYPPAMIWPRVLPAIALSKALRR
DREPSAWGIMTISRNRFFMVAFAAMFVWFWIPNFLFRALSLFNWTTWFSPGSTTLALITGSTCGLGLFNPLPSLD
WNIVTSMGDPIVTPLFTLLNFATGMLLSGLLAIPLYFGNFMNGSFLPINSNKIYDNTANIYDVKRILTPDLNLNE
EAYFNYAIPYMSTTVLIQMVAHFVVYVAVPLHIFLYFRRDIAAGIRSAWNRKSREDEFDDIHNRLMSAYPEVPHW
WYGVVLLISFVIACIAVSAFPTGMPIWGLLVAVGFTLLLQIPIGMLAAISNVEVSTSILAFLIAGFTLEGNVIGN
MIFKMYSFLATSQSLNFVGDLKMAHYCKIPPRWAFAAQLYASMLGGFISLGVNHWSLSNIKGICQEGQAERFVCP
FTHKFFVNTVLWGAIGPRRLFGSDGPYRATLYFLPLGIVLPLMVYWGARRWPSSWLRHVNTPIFIAGAVAWAPLN
ISYMQGTVVLALFFNRYVKARYNAWWQKYAYVLTASFSAATGVAALFLFFAFQRWNININWIGNSIAGQGVDQGG
FKSANGTVLKCSNMHLQPGESFASGF*
Coding >Ophcf2|06963
ATGGCATCAGAGCAGCGAGATCACAATGGTGGCCGCGACGAAGACGAGAAGAAGGACGACAAACGACGACAATCA
ACATGCACAATCGACCAAGACGAGAAGCAAGACTCTTCGTCTACAAAGGACACCCTCACCAACGGATCCGAGGGT
TCATCCTCACGACCCCTGAGCTCATCTACCCTTAATGAAAAAATATGGACACAACCCAAGGACGACAAATCATCA
GAATTTGACCTGACCCTTAAGCTTGAGGAGCCAGCAGACCTCGACCTAGCCTTCAAGCTAGAAAAATCATCAGAC
TCCGACTCATCTCTCATCCAATCGACCGTCAAAGTCGAAGAATCATCCGAGCTTCAGTCCCAAGACTCAACAGAG
ACCCTATCAGAAGAAGCGCTGGACGCCCAACTAAAAGACCTAATCATCAAGCACGAATTCGATCAAAACTTCCCA
ACCGAGCTCCTCTCCCGCGCCCGAGCCTTCACACAGGGAACAAACGGCGCGCGATCCGAGGCTGAGATATCGGCT
GGCCATGAAGCCATCAAGTCCTTCCGCGAGTTTGACGAGCTGGTCAGAAACAGCAGTCCGTACATGGAGGTCCGT
TCCGTCGTCGATGTTACCGATGATCCTTCTGTTCCGGTCGGTACTTTTCGCGTCTTTGTGCTGGGGACTTTCTTT
ACGGCTTTGGGGAGTGGCATCAGTCAGTTCTTCTCTTTGAGGTTGCCCAGCATTGAGATTTCTACCTTTGTGATT
CAGTTGCTTGCCATGCCGCTCGGAATCGCAATGGCTCGCTGGATACCAAAGGATAAACACGTGGGCTTCAGGGGC
TGGACCGTCAACCTCAACCCGGGCGAGTTTACGCAAAAGGAGCACCTCCTCGTGGCGATGATGGGCAACACTCTC
ACCAGTCCCTACATCGTCTCCATCGTACAAGTCCTCAAGCTGGACTTGTTCTACGGCGAAAAGGTACTATCATCG
TCTATCCTGTGGCAGGTCCTCACCCTCGTTTCCTCACAACTTCTCGGCTATGGCTGCGCCGGCTTGACGAGACGC
TTCCTCATCTATCCGCCTGCCATGATCTGGCCGAGGGTCTTGCCGGCCATCGCCCTGTCCAAAGCTCTACGACGA
GATCGCGAGCCTTCCGCCTGGGGCATCATGACGATTTCACGGAATCGCTTCTTCATGGTTGCTTTCGCTGCCATG
TTCGTCTGGTTCTGGATCCCGAACTTCTTGTTTCGGGCTCTGTCGCTCTTCAACTGGACGACTTGGTTCTCTCCG
GGAAGCACGACGCTGGCTCTCATCACCGGCAGCACGTGCGGGCTCGGGCTCTTCAACCCTCTTCCCTCACTGGAT
TGGAACATCGTCACCAGCATGGGAGACCCCATCGTCACTCCGCTGTTTACCTTGCTGAACTTTGCTACGGGGATG
CTTCTCTCCGGTCTGCTTGCCATCCCTCTCTACTTTGGCAACTTCATGAACGGTTCTTTCTTGCCGATTAACAGC
AACAAGATCTATGACAACACTGCCAACATCTACGACGTCAAGAGGATACTGACTCCCGATCTGAACCTGAACGAG
GAGGCTTACTTCAACTACGCCATCCCTTACATGTCAACGACGGTGCTGATCCAGATGGTGGCCCACTTCGTCGTC
TACGTCGCCGTGCCCCTACACATCTTCCTATACTTCAGAAGAGACATCGCGGCCGGCATCCGCTCAGCCTGGAAC
CGAAAGTCACGGGAAGACGAGTTTGACGACATCCACAACCGCTTAATGTCGGCCTACCCCGAGGTGCCGCACTGG
TGGTACGGCGTCGTGCTGCTCATCTCGTTTGTCATCGCCTGCATCGCCGTCAGTGCGTTTCCCACGGGGATGCCG
ATCTGGGGGCTTCTCGTCGCCGTTGGCTTCACCCTGTTGCTTCAGATTCCCATTGGTATGCTGGCGGCCATCTCG
AATGTCGAGGTTTCGACATCCATCTTGGCCTTTCTCATAGCGGGCTTTACTCTGGAAGGGAACGTCATTGGCAAC
ATGATTTTCAAGATGTATTCCTTCTTGGCAACGAGTCAATCCTTGAACTTTGTCGGTGACCTGAAAATGGCACAT
TACTGCAAGATCCCTCCTCGATGGGCCTTTGCCGCTCAGCTATACGCCTCTATGCTCGGCGGCTTCATCTCTCTC
GGCGTCAACCACTGGAGCCTAAGCAACATCAAAGGCATATGCCAAGAAGGCCAGGCCGAACGCTTCGTCTGCCCC
TTCACCCACAAGTTTTTCGTCAACACGGTCCTCTGGGGCGCCATCGGACCCCGAAGGCTCTTTGGGAGCGATGGT
CCCTATCGAGCTACGCTCTACTTTCTGCCATTGGGCATCGTGCTCCCCCTGATGGTCTACTGGGGGGCACGTCGC
TGGCCGAGTTCATGGCTGCGTCACGTCAACACTCCCATCTTCATCGCAGGTGCTGTGGCCTGGGCCCCCTTGAAC
ATCTCATACATGCAAGGCACGGTTGTGCTCGCCTTGTTCTTCAACCGCTACGTCAAGGCGAGGTACAATGCTTGG
TGGCAAAAGTACGCCTACGTGCTCACGGCGTCCTTCTCGGCCGCTACCGGCGTCGCCGCTCTGTTCCTCTTCTTT
GCGTTCCAGAGATGGAACATCAATATCAACTGGATTGGCAACTCGATCGCTGGCCAGGGTGTTGATCAAGGAGGA
TTCAAGTCCGCAAACGGGACGGTGCTGAAGTGTTCCAACATGCACTTGCAACCGGGAGAGTCGTTTGCTTCTGGC
TTCTAG
Transcript >Ophcf2|06963
ATGGCATCAGAGCAGCGAGATCACAATGGTGGCCGCGACGAAGACGAGAAGAAGGACGACAAACGACGACAATCA
ACATGCACAATCGACCAAGACGAGAAGCAAGACTCTTCGTCTACAAAGGACACCCTCACCAACGGATCCGAGGGT
TCATCCTCACGACCCCTGAGCTCATCTACCCTTAATGAAAAAATATGGACACAACCCAAGGACGACAAATCATCA
GAATTTGACCTGACCCTTAAGCTTGAGGAGCCAGCAGACCTCGACCTAGCCTTCAAGCTAGAAAAATCATCAGAC
TCCGACTCATCTCTCATCCAATCGACCGTCAAAGTCGAAGAATCATCCGAGCTTCAGTCCCAAGACTCAACAGAG
ACCCTATCAGAAGAAGCGCTGGACGCCCAACTAAAAGACCTAATCATCAAGCACGAATTCGATCAAAACTTCCCA
ACCGAGCTCCTCTCCCGCGCCCGAGCCTTCACACAGGGAACAAACGGCGCGCGATCCGAGGCTGAGATATCGGCT
GGCCATGAAGCCATCAAGTCCTTCCGCGAGTTTGACGAGCTGGTCAGAAACAGCAGTCCGTACATGGAGGTCCGT
TCCGTCGTCGATGTTACCGATGATCCTTCTGTTCCGGTCGGTACTTTTCGCGTCTTTGTGCTGGGGACTTTCTTT
ACGGCTTTGGGGAGTGGCATCAGTCAGTTCTTCTCTTTGAGGTTGCCCAGCATTGAGATTTCTACCTTTGTGATT
CAGTTGCTTGCCATGCCGCTCGGAATCGCAATGGCTCGCTGGATACCAAAGGATAAACACGTGGGCTTCAGGGGC
TGGACCGTCAACCTCAACCCGGGCGAGTTTACGCAAAAGGAGCACCTCCTCGTGGCGATGATGGGCAACACTCTC
ACCAGTCCCTACATCGTCTCCATCGTACAAGTCCTCAAGCTGGACTTGTTCTACGGCGAAAAGGTACTATCATCG
TCTATCCTGTGGCAGGTCCTCACCCTCGTTTCCTCACAACTTCTCGGCTATGGCTGCGCCGGCTTGACGAGACGC
TTCCTCATCTATCCGCCTGCCATGATCTGGCCGAGGGTCTTGCCGGCCATCGCCCTGTCCAAAGCTCTACGACGA
GATCGCGAGCCTTCCGCCTGGGGCATCATGACGATTTCACGGAATCGCTTCTTCATGGTTGCTTTCGCTGCCATG
TTCGTCTGGTTCTGGATCCCGAACTTCTTGTTTCGGGCTCTGTCGCTCTTCAACTGGACGACTTGGTTCTCTCCG
GGAAGCACGACGCTGGCTCTCATCACCGGCAGCACGTGCGGGCTCGGGCTCTTCAACCCTCTTCCCTCACTGGAT
TGGAACATCGTCACCAGCATGGGAGACCCCATCGTCACTCCGCTGTTTACCTTGCTGAACTTTGCTACGGGGATG
CTTCTCTCCGGTCTGCTTGCCATCCCTCTCTACTTTGGCAACTTCATGAACGGTTCTTTCTTGCCGATTAACAGC
AACAAGATCTATGACAACACTGCCAACATCTACGACGTCAAGAGGATACTGACTCCCGATCTGAACCTGAACGAG
GAGGCTTACTTCAACTACGCCATCCCTTACATGTCAACGACGGTGCTGATCCAGATGGTGGCCCACTTCGTCGTC
TACGTCGCCGTGCCCCTACACATCTTCCTATACTTCAGAAGAGACATCGCGGCCGGCATCCGCTCAGCCTGGAAC
CGAAAGTCACGGGAAGACGAGTTTGACGACATCCACAACCGCTTAATGTCGGCCTACCCCGAGGTGCCGCACTGG
TGGTACGGCGTCGTGCTGCTCATCTCGTTTGTCATCGCCTGCATCGCCGTCAGTGCGTTTCCCACGGGGATGCCG
ATCTGGGGGCTTCTCGTCGCCGTTGGCTTCACCCTGTTGCTTCAGATTCCCATTGGTATGCTGGCGGCCATCTCG
AATGTCGAGGTTTCGACATCCATCTTGGCCTTTCTCATAGCGGGCTTTACTCTGGAAGGGAACGTCATTGGCAAC
ATGATTTTCAAGATGTATTCCTTCTTGGCAACGAGTCAATCCTTGAACTTTGTCGGTGACCTGAAAATGGCACAT
TACTGCAAGATCCCTCCTCGATGGGCCTTTGCCGCTCAGCTATACGCCTCTATGCTCGGCGGCTTCATCTCTCTC
GGCGTCAACCACTGGAGCCTAAGCAACATCAAAGGCATATGCCAAGAAGGCCAGGCCGAACGCTTCGTCTGCCCC
TTCACCCACAAGTTTTTCGTCAACACGGTCCTCTGGGGCGCCATCGGACCCCGAAGGCTCTTTGGGAGCGATGGT
CCCTATCGAGCTACGCTCTACTTTCTGCCATTGGGCATCGTGCTCCCCCTGATGGTCTACTGGGGGGCACGTCGC
TGGCCGAGTTCATGGCTGCGTCACGTCAACACTCCCATCTTCATCGCAGGTGCTGTGGCCTGGGCCCCCTTGAAC
ATCTCATACATGCAAGGCACGGTTGTGCTCGCCTTGTTCTTCAACCGCTACGTCAAGGCGAGGTACAATGCTTGG
TGGCAAAAGTACGCCTACGTGCTCACGGCGTCCTTCTCGGCCGCTACCGGCGTCGCCGCTCTGTTCCTCTTCTTT
GCGTTCCAGAGATGGAACATCAATATCAACTGGATTGGCAACTCGATCGCTGGCCAGGGTGTTGATCAAGGAGGA
TTCAAGTCCGCAAACGGGACGGTGCTGAAGTGTTCCAACATGCACTTGCAACCGGGAGAGTCGTTTGCTTCTGGC
TTCTAG
Gene >Ophcf2|06963
ATGGCATCAGAGCAGCGAGATCACAATGGTGGCCGCGACGAAGACGAGAAGAAGGACGACAAACGACGACAATCA
ACATGCACAATCGACCAAGACGAGAAGCAAGACTCTTCGTCTACAAAGGACACCCTCACCAACGGATCCGAGGGT
TCATCCTCACGACCCCTGAGCTCATCTACCCTTAATGAAAAAATATGGACACAACCCAAGGACGACAAATCATCA
GAATTTGACCTGACCCTTAAGCTTGAGGAGCCAGCAGACCTCGACCTAGCCTTCAAGCTAGAAAAATCATCAGAC
TCCGACTCATCTCTCATCCAATCGACCGTCAAAGTCGAAGAATCATCCGAGCTTCAGTCCCAAGACTCAACAGAG
ACCCTATCAGAAGAAGCGCTGGACGCCCAACTAAAAGACCTAATCATCAAGCACGAATTCGATCAAAACTTCCCA
ACCGAGCTCCTCTCCCGCGCCCGAGCCTTCACACAGGGAACAAACGGCGCGCGATCCGAGGCTGAGATATCGGCT
GGCCATGAAGCCATCAAGTCCTTCCGCGAGTTTGACGAGCTGGTCAGAAACAGCAGTCCGTACATGGAGGTCCGT
TCCGTCGTCGATGTTACCGATGATCCTTCTGTTCCGGTCGGTACTTTTCGCGTCTTTGTGCTGGGGACTTTCTTT
ACGGCTTTGGGGAGTGGCATCAGTCAGTTCTTCTCTTTGAGGTTGCCCAGCATTGAGATTTCTACCTTTGTGATT
CAGTTGCTTGCCATGCCGCTCGGAATCGCAATGGCTCGCTGGATACCAAAGGATAAACACGTGGGCTTCAGGGGC
TGGACCGTCAACCTCAACCCGGGCGAGTTTACGCAAAAGGAGCACCTCCTCGTGGCGATGATGGGCAACACTCTC
ACCAGTCCCTACATCGTCTCCATCGTACAAGTCCTCAAGCTGGACTTGTTCTACGGCGAAAAGGTACTATCATCG
TCTATCCTGTGGCAGGTCCTCACCCTCGTTTCCTCACAACTTCTCGGCTATGGCTGCGCCGGCTTGACGAGACGC
TTCCTCATCTATCCGCCTGCCATGATCTGGCCGAGGGTCTTGCCGGCCATCGCCCTGTCCAAAGCTCTACGACGA
GATCGCGAGCCTTCCGCCTGGGGCATCATGACGATTTCACGGAATCGCTTCTTCATGGTTGCTTTCGCTGCCATG
TTCGTCTGGTTCTGGATCCCGAACTTCTTGTTTCGGGCTCTGTCGCTCTTCAACTGGACGACTTGGTTCTCTCCG
GGAAGCACGACGCTGGCTCTCATCACCGGCAGCACGTGCGGGCTCGGGCTCTTCAACCCTCTTCCCTCACTGGAT
TGGAACATCGTCACCAGCATGGGAGACCCCATCGTCACTCCGCTGTTTACCTTGCTGAACTTTGCTACGGGGATG
CTTCTCTCCGGTCTGCTTGCCATCCCTCTCTACTTTGGCAACTTCATGAACGGTTCTTTCTTGCCGATTAACAGC
AACAAGATCTATGACAACACTGCCAACATCTACGACGTCAAGAGGATACTGACTCCCGATCTGAACCTGAACGAG
GAGGCTTACTTCAACTACGCCATCCCTTACATGTCAACGACGGTGCTGATCCAGATGGTGGCCCACTTCGTCGTC
TACGTCGCCGTGCCCCTACACATCTTCCTATACTTCAGAAGAGACATCGCGGCCGGCATCCGCTCAGCCTGGAAC
CGAAAGTCACGGGAAGACGAGTTTGACGACATCCACAACCGCTTAATGTCGGCCTACCCCGAGGTGCCGCACTGG
TGGTACGGCGTCGTGCTGCTCATCTCGTTTGTCATCGCCTGCATCGCCGTCAGTGCGTTTCCCACGGGGATGCCG
ATCTGGGGGCTTCTCGTCGCCGTTGGCTTCACCCTGTTGCTTCAGATTCCCATTGGTATGCTGGCGGCCATCTCG
AATGTCGAGGTTTCGACATCCATCTTGGCCTTTCTCATAGCGGGCTTTACTCTGGAAGGGAACGTCATTGGCAAC
ATGATTTTCAAGATGTATTCCTTCTTGGCAACGAGGTATGTTACGTTACACTGCTCTGTCATGGACGCTTGCTAA
CCTCTGCTGCTTCAGTCAATCCTTGAACTTTGTCGGTGACCTGAAAATGGTAATTCCTCACTCATTCTTACGCCG
CCAGTTCTCTCTTTACTGATGCCTTTCCAGGCACATTACTGCAAGATCCCTCCTCGATGGGCCTTTGCCGCTCAG
CTATACGCCTCTATGCTCGGCGGCTTCATCTCTCTCGGCGTCAACCACTGGAGCCTAAGCAACATCAAAGGCATA
TGCCAAGAAGGCCAGGCCGAACGCTTCGTCTGCCCCTTCACCCACAAGTTTTTCGTCAACACGGTCCTCTGGGGC
GCCATCGGACCCCGAAGGCTCTTTGGGAGCGATGGTCCCTATCGAGCTACGCTCTACTTTCTGCCATTGGGCATC
GTGCTCCCCCTGATGGTCTACTGGGGGGCACGTCGCTGGCCGAGTTCATGGCTGCGTCACGTCAACACTCCCATC
TTCATCGCAGGTGCTGTGGCCTGGGCCCCCTTGAACATCTCATACATGCAAGGCACGGTTGTGCTCGCCTTGTTC
TTCAACCGCTACGTCAAGGCGAGGTACAATGCTTGGTGGCAAAAGTACGCCTACGTGCTCACGGCGTCCTTCTCG
GCCGCTACCGGCGTCGCCGCTCTGTTCCTCTTCTTTGCGTTCCAGAGATGGAACATCAATATCAACTGGATTGGC
AACTCGATCGCTGGCCAGGGTGTTGATCAAGGAGGATTCAAGTCCGCAAACGGGACGGTGCTGAAGTGTTCCAAC
ATGCACTTGCAACCGGGAGAGTCGTTTGCTTCTGGCTTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail