Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06958
Gene name
Locationscaffold_09:136075..136993
Strand-
Gene length (bp)918
Transcript length (bp)918
Coding sequence length (bp)918
Protein length (aa) 306

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17667 Pkinase_fungal Fungal protein kinase 1.4E-69 1 302

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus|Extracellular Nuclear localization signal 0.1917 0.9125 0.7212 0.0082 0.0789 0.0021 0.0248 0.0197 0.0071 0.0066

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 55.39 29.33 81.45
Alive In ants, during behavior modification 35.44 17.18 53.70
Dead In ants, recently dead 37.39 18.43 56.35

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.036100 yes
Alive Dead 0.825729 no
Dead Fungus 0.064141 no

Orthologs

Orthofinder run ID4
Orthogroup58
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4910
Ophiocordyceps camponoti-floridani Ophcf2|06958 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4560
Ophiocordyceps camponoti-rufipedis Ophun1|3608
Ophiocordyceps camponoti-rufipedis Ophun1|3607
Ophiocordyceps camponoti-rufipedis Ophun1|3606
Ophiocordyceps camponoti-rufipedis Ophun1|1918
Ophiocordyceps camponoti-rufipedis Ophun1|4301
Ophiocordyceps kimflemingae Ophio5|7704
Ophiocordyceps subramaniannii Hirsu2|299
Ophiocordyceps subramaniannii Hirsu2|8307
Ophiocordyceps subramaniannii Hirsu2|8186
Ophiocordyceps subramaniannii Hirsu2|7741
Ophiocordyceps subramaniannii Hirsu2|7709
Ophiocordyceps subramaniannii Hirsu2|5174
Ophiocordyceps subramaniannii Hirsu2|4474
Ophiocordyceps subramaniannii Hirsu2|3083
Ophiocordyceps subramaniannii Hirsu2|86
Ophiocordyceps subramaniannii Hirsu2|8924

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06958
MELFVFDRAGAYSSGKFSIHDEPDKFARAIVGYLTMTHEDMGIDTFIKRLSEDVISLCDTAGKETKFTLEQLLST
SRRTTCFSTENYAKAVKFSWTSEGGAQEADLLILAEERGVKGVPRLVAYNRKTSIAELRQDLEFPRPKLNKRKLP
ALLSDSDSGDDCHRYKWRRCSDWEMPGEYDGPPPGLTESSEKPFINKIYNCLVVAPYGRPISNFESAMELLESMR
DAIRAHESLYVKAGILHRDVSPSNILITKPDLADGYKGILIDLDHTHRCDAKMTEKHIGTLPFMAVGLLLEKDHT
YRLSP*
Coding >Ophcf2|06958
ATGGAACTCTTCGTTTTCGATCGAGCTGGAGCCTACAGCTCCGGGAAATTCAGCATTCATGACGAGCCGGACAAG
TTTGCTCGGGCAATCGTCGGTTACTTGACGATGACTCACGAGGACATGGGGATAGACACCTTCATCAAGCGGCTC
TCCGAGGATGTCATCTCTCTGTGCGACACTGCCGGCAAAGAAACAAAGTTCACGTTGGAGCAACTCCTCTCAACC
AGCAGAAGGACGACATGTTTTTCGACGGAAAACTATGCCAAGGCCGTCAAGTTCTCTTGGACCTCAGAGGGCGGT
GCGCAAGAAGCTGACTTGCTGATACTGGCGGAAGAGCGCGGCGTCAAGGGCGTTCCCAGGCTTGTGGCCTATAAT
CGGAAAACCAGCATCGCAGAACTTCGCCAAGATCTGGAATTTCCGAGACCCAAACTCAACAAGCGAAAACTTCCC
GCCTTACTTTCAGACAGCGACTCTGGCGACGACTGTCACAGATACAAGTGGCGCCGTTGCAGTGACTGGGAGATG
CCAGGCGAGTACGACGGTCCGCCTCCTGGATTGACCGAGTCGAGCGAGAAGCCGTTCATCAACAAAATTTACAAC
TGCCTGGTCGTTGCGCCGTACGGCCGCCCCATCAGTAACTTTGAATCGGCCATGGAACTTCTGGAGTCCATGCGA
GACGCAATCAGGGCACACGAATCGCTCTACGTCAAAGCAGGGATACTGCATCGAGACGTCTCTCCGAGCAACATT
CTCATCACGAAGCCTGACCTGGCGGACGGCTACAAGGGCATCCTCATCGACCTGGATCACACGCACCGATGCGAT
GCCAAGATGACGGAGAAGCACATCGGGACGTTGCCTTTCATGGCAGTGGGTCTGCTACTGGAGAAAGATCACACC
TATAGGCTATCGCCATGA
Transcript >Ophcf2|06958
ATGGAACTCTTCGTTTTCGATCGAGCTGGAGCCTACAGCTCCGGGAAATTCAGCATTCATGACGAGCCGGACAAG
TTTGCTCGGGCAATCGTCGGTTACTTGACGATGACTCACGAGGACATGGGGATAGACACCTTCATCAAGCGGCTC
TCCGAGGATGTCATCTCTCTGTGCGACACTGCCGGCAAAGAAACAAAGTTCACGTTGGAGCAACTCCTCTCAACC
AGCAGAAGGACGACATGTTTTTCGACGGAAAACTATGCCAAGGCCGTCAAGTTCTCTTGGACCTCAGAGGGCGGT
GCGCAAGAAGCTGACTTGCTGATACTGGCGGAAGAGCGCGGCGTCAAGGGCGTTCCCAGGCTTGTGGCCTATAAT
CGGAAAACCAGCATCGCAGAACTTCGCCAAGATCTGGAATTTCCGAGACCCAAACTCAACAAGCGAAAACTTCCC
GCCTTACTTTCAGACAGCGACTCTGGCGACGACTGTCACAGATACAAGTGGCGCCGTTGCAGTGACTGGGAGATG
CCAGGCGAGTACGACGGTCCGCCTCCTGGATTGACCGAGTCGAGCGAGAAGCCGTTCATCAACAAAATTTACAAC
TGCCTGGTCGTTGCGCCGTACGGCCGCCCCATCAGTAACTTTGAATCGGCCATGGAACTTCTGGAGTCCATGCGA
GACGCAATCAGGGCACACGAATCGCTCTACGTCAAAGCAGGGATACTGCATCGAGACGTCTCTCCGAGCAACATT
CTCATCACGAAGCCTGACCTGGCGGACGGCTACAAGGGCATCCTCATCGACCTGGATCACACGCACCGATGCGAT
GCCAAGATGACGGAGAAGCACATCGGGACGTTGCCTTTCATGGCAGTGGGTCTGCTACTGGAGAAAGATCACACC
TATAGGCTATCGCCATGA
Gene >Ophcf2|06958
ATGGAACTCTTCGTTTTCGATCGAGCTGGAGCCTACAGCTCCGGGAAATTCAGCATTCATGACGAGCCGGACAAG
TTTGCTCGGGCAATCGTCGGTTACTTGACGATGACTCACGAGGACATGGGGATAGACACCTTCATCAAGCGGCTC
TCCGAGGATGTCATCTCTCTGTGCGACACTGCCGGCAAAGAAACAAAGTTCACGTTGGAGCAACTCCTCTCAACC
AGCAGAAGGACGACATGTTTTTCGACGGAAAACTATGCCAAGGCCGTCAAGTTCTCTTGGACCTCAGAGGGCGGT
GCGCAAGAAGCTGACTTGCTGATACTGGCGGAAGAGCGCGGCGTCAAGGGCGTTCCCAGGCTTGTGGCCTATAAT
CGGAAAACCAGCATCGCAGAACTTCGCCAAGATCTGGAATTTCCGAGACCCAAACTCAACAAGCGAAAACTTCCC
GCCTTACTTTCAGACAGCGACTCTGGCGACGACTGTCACAGATACAAGTGGCGCCGTTGCAGTGACTGGGAGATG
CCAGGCGAGTACGACGGTCCGCCTCCTGGATTGACCGAGTCGAGCGAGAAGCCGTTCATCAACAAAATTTACAAC
TGCCTGGTCGTTGCGCCGTACGGCCGCCCCATCAGTAACTTTGAATCGGCCATGGAACTTCTGGAGTCCATGCGA
GACGCAATCAGGGCACACGAATCGCTCTACGTCAAAGCAGGGATACTGCATCGAGACGTCTCTCCGAGCAACATT
CTCATCACGAAGCCTGACCTGGCGGACGGCTACAAGGGCATCCTCATCGACCTGGATCACACGCACCGATGCGAT
GCCAAGATGACGGAGAAGCACATCGGGACGTTGCCTTTCATGGCAGTGGGTCTGCTACTGGAGAAAGATCACACC
TATAGGCTATCGCCATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail