Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06956
Gene name
Locationscaffold_09:130086..131922
Strand+
Gene length (bp)1836
Transcript length (bp)1671
Coding sequence length (bp)1671
Protein length (aa) 557

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04515 Choline_transpo Plasma-membrane choline transporter 6.1E-79 210 529

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.45

Transmembrane Domains

Domain # Start End Length
1 115 137 22
2 152 174 22
3 181 203 22
4 208 227 19
5 248 270 22
6 349 371 22
7 391 413 22
8 454 476 22
9 489 511 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 106.66 59.65 153.67
Alive In ants, during behavior modification 52.14 29.70 74.58
Dead In ants, recently dead 101.92 56.51 147.34

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.000238 yes
Dead Fungus 0.853645 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06956
MNKTDGYAGPAQQQQQQQQQQQYGQPQYGQQHYGQPQYGQQQYGQQSYYYGGSNHDGQQPYPPQDPYGPPHDAYN
QPQPSYAPPPPYSFNPPQPNDDKYSFEQAFKIDRPKYNDLWAGILFLVVFAGYVAVSAISIRGWSTRGGSGVVSR
NTVALFGWVVLAALILSYGYVWMARLFPKQFIWVTGILNLCFLYATAIYYLYIRSYGPGIIFLIMAVFTTFAAFT
WIKRIPFSALMLKTSVDVARKYGHVYLVSLLGGLLGVILAAWYGVTVTAIYVRFRPEDNCSSAQGENCSSGTVIG
LIVYVTFAMYWTSEWLKNTVHTTVSGVYGSWYFCPHNFPKAATRGAMKRALTYSFGSISLGSLLVAMVNMLRQIC
SIAGQQAANDGGVMDVVFYVISLIVGCLLSLLQWAIEFVNRYAFSYIALYGKAYFPAAKDTWTMIRDRGIDALVN
ECLIGPVLSFGAIFIGAVCTLLAFLFVRISHSQLQSNNGYLAAVMAFAFLVGFQITNIFTTPISSGIDTIFVASG
WDPQVMYSEHPELYQDMVSVYPQVQQAIVAR*
Coding >Ophcf2|06956
ATGAACAAGACCGACGGCTACGCGGGCCCTGCTCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGTATGGCCAG
CCGCAGTACGGACAGCAGCACTATGGCCAGCCGCAATACGGACAGCAGCAATACGGCCAGCAGAGCTACTACTAC
GGCGGCTCCAACCACGACGGCCAGCAGCCATACCCTCCACAGGACCCCTACGGCCCTCCGCACGACGCCTACAAT
CAGCCACAGCCGTCGTACGCGCCACCTCCGCCGTACAGCTTCAACCCGCCGCAGCCCAACGACGACAAATACTCG
TTCGAGCAGGCCTTCAAGATTGACCGTCCCAAGTACAATGACCTCTGGGCTGGCATTCTCTTTCTCGTCGTCTTT
GCTGGTTACGTCGCCGTCTCTGCCATTTCCATTCGAGGATGGTCCACCAGAGGCGGCAGCGGCGTCGTCAGCCGT
AACACCGTCGCTCTCTTCGGCTGGGTTGTGCTCGCCGCGCTGATCCTCTCGTACGGTTACGTCTGGATGGCCCGT
CTCTTCCCTAAGCAGTTCATCTGGGTCACCGGCATCCTCAACCTCTGTTTCCTCTACGCGACGGCCATATACTAT
CTGTATATACGGAGTTACGGCCCAGGCATCATTTTTCTCATCATGGCCGTCTTCACCACCTTTGCGGCCTTTACG
TGGATCAAACGAATACCCTTTTCGGCCTTGATGCTCAAGACATCCGTCGACGTTGCCCGCAAATACGGCCACGTC
TATCTCGTCAGCCTGCTCGGTGGCCTCCTGGGTGTCATCCTGGCTGCCTGGTACGGCGTCACGGTGACGGCCATC
TACGTCCGCTTCCGACCCGAAGACAACTGCAGCAGCGCCCAGGGCGAGAACTGCAGCAGCGGCACCGTCATCGGC
CTCATCGTCTATGTCACCTTTGCCATGTACTGGACGTCGGAGTGGCTGAAGAACACGGTTCACACGACCGTGTCT
GGCGTCTACGGGTCGTGGTACTTTTGCCCTCACAACTTTCCCAAGGCCGCCACTCGCGGCGCCATGAAGCGCGCC
CTCACCTACAGCTTTGGCTCCATCAGTCTTGGGAGCTTGCTGGTGGCCATGGTCAACATGTTGCGCCAGATCTGT
TCCATTGCCGGTCAGCAGGCCGCCAACGACGGCGGGGTCATGGACGTCGTCTTCTATGTCATCTCCTTGATCGTC
GGCTGCCTTCTGTCGCTTCTTCAGTGGGCCATCGAGTTCGTTAACCGCTACGCCTTCTCGTACATTGCGCTGTAC
GGCAAGGCGTATTTCCCGGCGGCCAAGGACACGTGGACCATGATTCGGGATCGCGGCATCGATGCCCTGGTCAAT
GAATGCCTCATCGGACCCGTGCTCTCGTTCGGGGCCATATTCATAGGCGCCGTCTGCACCCTTCTCGCCTTTCTC
TTTGTCCGAATCAGCCACTCGCAGCTGCAATCCAACAACGGCTACTTGGCGGCCGTCATGGCCTTTGCCTTTCTC
GTCGGCTTCCAGATCACCAACATCTTTACGACGCCCATCTCGAGCGGCATCGACACCATCTTTGTCGCCTCGGGC
TGGGATCCTCAGGTCATGTACAGCGAGCACCCGGAGCTGTATCAGGATATGGTGAGCGTGTATCCGCAGGTGCAG
CAGGCCATCGTAGCTCGTTGA
Transcript >Ophcf2|06956
ATGAACAAGACCGACGGCTACGCGGGCCCTGCTCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGTATGGCCAG
CCGCAGTACGGACAGCAGCACTATGGCCAGCCGCAATACGGACAGCAGCAATACGGCCAGCAGAGCTACTACTAC
GGCGGCTCCAACCACGACGGCCAGCAGCCATACCCTCCACAGGACCCCTACGGCCCTCCGCACGACGCCTACAAT
CAGCCACAGCCGTCGTACGCGCCACCTCCGCCGTACAGCTTCAACCCGCCGCAGCCCAACGACGACAAATACTCG
TTCGAGCAGGCCTTCAAGATTGACCGTCCCAAGTACAATGACCTCTGGGCTGGCATTCTCTTTCTCGTCGTCTTT
GCTGGTTACGTCGCCGTCTCTGCCATTTCCATTCGAGGATGGTCCACCAGAGGCGGCAGCGGCGTCGTCAGCCGT
AACACCGTCGCTCTCTTCGGCTGGGTTGTGCTCGCCGCGCTGATCCTCTCGTACGGTTACGTCTGGATGGCCCGT
CTCTTCCCTAAGCAGTTCATCTGGGTCACCGGCATCCTCAACCTCTGTTTCCTCTACGCGACGGCCATATACTAT
CTGTATATACGGAGTTACGGCCCAGGCATCATTTTTCTCATCATGGCCGTCTTCACCACCTTTGCGGCCTTTACG
TGGATCAAACGAATACCCTTTTCGGCCTTGATGCTCAAGACATCCGTCGACGTTGCCCGCAAATACGGCCACGTC
TATCTCGTCAGCCTGCTCGGTGGCCTCCTGGGTGTCATCCTGGCTGCCTGGTACGGCGTCACGGTGACGGCCATC
TACGTCCGCTTCCGACCCGAAGACAACTGCAGCAGCGCCCAGGGCGAGAACTGCAGCAGCGGCACCGTCATCGGC
CTCATCGTCTATGTCACCTTTGCCATGTACTGGACGTCGGAGTGGCTGAAGAACACGGTTCACACGACCGTGTCT
GGCGTCTACGGGTCGTGGTACTTTTGCCCTCACAACTTTCCCAAGGCCGCCACTCGCGGCGCCATGAAGCGCGCC
CTCACCTACAGCTTTGGCTCCATCAGTCTTGGGAGCTTGCTGGTGGCCATGGTCAACATGTTGCGCCAGATCTGT
TCCATTGCCGGTCAGCAGGCCGCCAACGACGGCGGGGTCATGGACGTCGTCTTCTATGTCATCTCCTTGATCGTC
GGCTGCCTTCTGTCGCTTCTTCAGTGGGCCATCGAGTTCGTTAACCGCTACGCCTTCTCGTACATTGCGCTGTAC
GGCAAGGCGTATTTCCCGGCGGCCAAGGACACGTGGACCATGATTCGGGATCGCGGCATCGATGCCCTGGTCAAT
GAATGCCTCATCGGACCCGTGCTCTCGTTCGGGGCCATATTCATAGGCGCCGTCTGCACCCTTCTCGCCTTTCTC
TTTGTCCGAATCAGCCACTCGCAGCTGCAATCCAACAACGGCTACTTGGCGGCCGTCATGGCCTTTGCCTTTCTC
GTCGGCTTCCAGATCACCAACATCTTTACGACGCCCATCTCGAGCGGCATCGACACCATCTTTGTCGCCTCGGGC
TGGGATCCTCAGGTCATGTACAGCGAGCACCCGGAGCTGTATCAGGATATGGTGAGCGTGTATCCGCAGGTGCAG
CAGGCCATCGTAGCTCGTTGA
Gene >Ophcf2|06956
ATGAACAAGACCGACGGCTACGCGGGCCCTGCTCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGTATGGCCAG
CCGCAGTACGGACAGCAGCACTATGGCCAGCCGCAATACGGACAGCAGCAATACGGCCAGCAGAGCTACTACTAC
GGCGGCTCCAACCACGACGGCCAGCAGCCATACCCTCCACAGGACCCCTACGGCCCTCCGCACGACGCCTACAAT
CAGCCACAGCCGTCGTACGCGCCACCTCCGCCGTACAGCTTCAACCCGCCGCAGCCCAACGACGACAAATACTCG
TTCGAGCAGGCCTTCAAGATTGACCGTCCCAAGTACAATGACCTCTGGGCTGGCATTCTCGTCCGTGTTGGCGTC
TCGCCTTTTTGCCTGTGACTTTTGCTGACTCGTGCCTCAGTTTCTCGTCGTCTTTGCTGGTTACGTCGCCGTCTC
TGCCATTTCCATTCGAGGATGGTCCACCAGAGGCGGCAGCGGCGTCGTCAGCCGTAACACCGTCGCTCTCTTCGG
CTGGGTTGTGCTCGCCGCGCTGATCCTCTCGTACGGTTACGTCTGGATGGCCCGTCTCTTCCCTAAGCAGTTCAT
CTGGGTCACCGGCATCCTCAACCTCTGTTTCCTCTACGCGACGGCCATATACTATCTGTATATACGGAGTTACGG
CCCAGGCATCATTTTTCTCATCATGGCCGTCTTCACCACCTTTGCGGCCTTTACGTGGATCAAACGAATACCCTT
TTCGGCCTTGATGCTCAAGACATCCGTCGACGTTGCCCGCAAATACGGCCACGTCTATCTCGTCAGCCTGCTCGG
TGGCCTCCTGGGTGTCATCCTGGCTGCCTGGTACGGCGTCACGGTGACGGCCATCTACGTCCGCTTCCGACCCGA
AGACAACTGCAGCAGCGCCCAGGGCGAGAACTGCAGCAGCGGCACCGTCATCGGCCTCATCGTCTATGTCACCTT
TGCCATGTACTGGACGTCGGAGTGGCTGAAGAACACGGTTCACACGACCGTGTCTGGCGTCTACGGGTCGTGGTA
CTTTTGCCCTCACAACTTTCCCAAGGCCGCCACTCGCGGCGCCATGAAGCGCGCCCTCACCTACAGCTTTGGCTC
CATCAGTCTTGGGAGCTTGCTGGTGGCCATGGTCAACATGTTGCGCCAGATCTGTTCCATTGCCGGTCAGCAGGC
CGCCAACGACGGCGGGGTCATGGACGTCGTCTTCTATGTCATCTCCTTGATCGTCGGCTGCCTTCTGTCGCTTCT
TCAGTGTAGGTTTCCAGCCACCATGGCCAGGATGGGCGAGCACGAGACTGACTCACCTCGGCAGGGGCCATCGAG
TTCGTTAACCGCTACGCCTTCTCGTACATTGCGCTGTACGGCAAGGCGTATTTCCCGGCGGCCAAGGACACGTGG
ACCATGATTCGGGATCGCGGCATCGATGCCCTGGTCAATGTGAGTTGTATCCCTTTCTCTTCCGACGCAGCCTGC
TAAGAGCTCATGCAGGAATGCCTCATCGGACCCGTGCTCTCGTTCGGGGCCATATTCATAGGCGCCGTCTGCACC
CTTCTCGCCTTTCTCTTTGTCCGAATCAGCCACTCGCAGCTGCAATCCAACAACGGCTACTTGGCGGCCGTCATG
GCCTTTGCCTTTCTCGTCGGCTTCCAGATCACCAACATCTTTACGACGCCCATCTCGAGCGGCATCGACACCATC
TTTGTCGCCTCGGGCTGGGATCCTCAGGTCATGTACAGCGAGCACCCGGAGCTGTATCAGGATATGGTGAGCGTG
TATCCGCAGGTGCAGCAGGCCATCGTAGCTCGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail