Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06955
Gene name
Locationscaffold_09:127336..128946
Strand-
Gene length (bp)1610
Transcript length (bp)1563
Coding sequence length (bp)1563
Protein length (aa) 521

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00067 p450 Cytochrome P450 4.6E-43 56 508

GO

GO Term Description Terminal node
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Yes
GO:0020037 heme binding Yes
GO:0005506 iron ion binding Yes
GO:0004497 monooxygenase activity Yes
GO:0043169 cation binding No
GO:0046914 transition metal ion binding No
GO:0046872 metal ion binding No
GO:1901363 heterocyclic compound binding No
GO:0046906 tetrapyrrole binding No
GO:0003824 catalytic activity No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0016491 oxidoreductase activity No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 15 0.5

Transmembrane Domains

Domain # Start End Length
1 2 24 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 6.24 2.19 10.29
Alive In ants, during behavior modification 1.32 0.14 2.50
Dead In ants, recently dead 1.16 0.03 2.29

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.759190 no
Dead Fungus 0.000238 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06955
MLILLLAALAAAYGFYSYLLSPLFFSPLSRIPAPHWSCAISSFWILRARKQFKENKTLSDAHSRHGPIVRVGPNT
LSVDSVDAIRTIYQGGFDKWSWYSVFDFYGVPCVFSSLGSHEHGRRKRIVSRVYSKSYIQSSPAVRAQGRAILLG
RLLPLLRREAARSEGIEMQSIILSTTMDLICAFNFGVQAGTNFLEDHESGRHWFDLYGYRFLHFFWPQEFPAFTS
LCSKLGFRLYPSSVDEAHQEIEDWNKRMCDEARDVLAREKSDLPPQDEPIVLRALYEGMEKAQELKGDKAVPSKT
TSTQHRHLEVASETLDHVLAGFDTSGVALGFLIWQLSQDPDLQDKLRAELLTVKAPSLDVLPESRDLDNLPLLHA
VIMETLRRHPPIPGSQPRITPYPSSKIAGYQVPGGVRISAMAGPLHLDETVYPDPLRWDHTRWLPGVKSGGEMKQ
MNRNFWAFGSGGRMCLGSNFAWNSLNQVTYLIYSNFRTSLVGHSSMEQMDAFVGRPKGEKLNVKLTPIGS*
Coding >Ophcf2|06955
ATGCTCATCCTTCTTCTCGCCGCCCTGGCCGCGGCTTACGGGTTCTATTCATACCTTCTTTCCCCCCTGTTCTTC
TCCCCCCTCTCACGGATTCCTGCCCCGCATTGGTCATGCGCCATTTCGAGTTTCTGGATCCTCCGGGCTCGAAAG
CAGTTCAAAGAGAACAAGACGCTCAGTGACGCCCATTCTCGTCATGGCCCCATCGTCAGGGTCGGCCCCAATACC
CTCAGCGTCGACAGCGTCGATGCCATCAGGACCATCTACCAGGGAGGCTTCGACAAGTGGTCGTGGTATTCCGTC
TTTGACTTTTACGGCGTGCCCTGCGTCTTCTCCTCTCTCGGCTCTCACGAGCACGGGCGGAGGAAACGCATCGTC
TCGCGCGTCTACTCCAAGTCATATATCCAGTCGTCGCCTGCCGTCAGAGCCCAGGGCAGGGCCATTCTTCTGGGC
CGACTTCTCCCTCTGCTTCGACGGGAAGCTGCCCGTTCGGAGGGAATCGAGATGCAGTCCATCATCCTGTCGACG
ACCATGGACCTCATCTGTGCCTTTAACTTCGGAGTGCAAGCCGGGACAAACTTCCTCGAGGACCACGAGTCCGGC
CGGCATTGGTTCGACCTCTACGGCTACAGATTTCTTCATTTCTTCTGGCCTCAAGAGTTTCCAGCCTTTACGTCT
CTTTGCTCCAAGCTCGGATTCCGGCTTTATCCCTCCTCCGTCGACGAGGCGCACCAGGAAATCGAGGATTGGAAC
AAGCGCATGTGTGACGAGGCTCGAGATGTACTCGCTCGAGAAAAGTCGGATCTCCCTCCTCAGGATGAACCTATC
GTCTTGCGGGCCCTCTACGAAGGCATGGAGAAGGCCCAAGAGCTCAAGGGCGACAAGGCGGTTCCCAGCAAGACG
ACGTCTACCCAGCATCGACATCTCGAGGTCGCTAGCGAGACGCTGGACCACGTATTAGCTGGCTTTGATACCTCC
GGCGTCGCCTTGGGCTTTCTCATCTGGCAGCTGTCTCAGGACCCGGACCTTCAAGACAAGCTTCGAGCTGAACTC
CTCACCGTCAAGGCGCCAAGTCTAGACGTCCTCCCCGAGTCCAGGGACCTTGACAACCTGCCTCTTCTACACGCT
GTCATCATGGAGACTCTCCGACGTCACCCTCCGATCCCCGGTTCCCAGCCGCGCATAACTCCATATCCGTCCAGC
AAGATTGCCGGTTACCAAGTGCCGGGGGGGGTCCGGATCTCGGCCATGGCCGGACCTCTGCATCTCGACGAGACT
GTCTACCCGGATCCGCTTCGATGGGACCATACGAGGTGGCTTCCCGGCGTGAAGTCCGGGGGAGAAATGAAACAG
ATGAATCGCAACTTCTGGGCATTCGGGAGCGGTGGGAGGATGTGCCTGGGCAGTAACTTTGCCTGGAATAGTCTC
AACCAAGTCACCTACTTGATCTACTCGAATTTCCGCACCTCGCTCGTTGGTCATAGTTCGATGGAGCAGATGGAC
GCCTTTGTTGGCCGCCCGAAGGGTGAGAAGCTGAATGTGAAGCTTACACCCATCGGATCTTGA
Transcript >Ophcf2|06955
ATGCTCATCCTTCTTCTCGCCGCCCTGGCCGCGGCTTACGGGTTCTATTCATACCTTCTTTCCCCCCTGTTCTTC
TCCCCCCTCTCACGGATTCCTGCCCCGCATTGGTCATGCGCCATTTCGAGTTTCTGGATCCTCCGGGCTCGAAAG
CAGTTCAAAGAGAACAAGACGCTCAGTGACGCCCATTCTCGTCATGGCCCCATCGTCAGGGTCGGCCCCAATACC
CTCAGCGTCGACAGCGTCGATGCCATCAGGACCATCTACCAGGGAGGCTTCGACAAGTGGTCGTGGTATTCCGTC
TTTGACTTTTACGGCGTGCCCTGCGTCTTCTCCTCTCTCGGCTCTCACGAGCACGGGCGGAGGAAACGCATCGTC
TCGCGCGTCTACTCCAAGTCATATATCCAGTCGTCGCCTGCCGTCAGAGCCCAGGGCAGGGCCATTCTTCTGGGC
CGACTTCTCCCTCTGCTTCGACGGGAAGCTGCCCGTTCGGAGGGAATCGAGATGCAGTCCATCATCCTGTCGACG
ACCATGGACCTCATCTGTGCCTTTAACTTCGGAGTGCAAGCCGGGACAAACTTCCTCGAGGACCACGAGTCCGGC
CGGCATTGGTTCGACCTCTACGGCTACAGATTTCTTCATTTCTTCTGGCCTCAAGAGTTTCCAGCCTTTACGTCT
CTTTGCTCCAAGCTCGGATTCCGGCTTTATCCCTCCTCCGTCGACGAGGCGCACCAGGAAATCGAGGATTGGAAC
AAGCGCATGTGTGACGAGGCTCGAGATGTACTCGCTCGAGAAAAGTCGGATCTCCCTCCTCAGGATGAACCTATC
GTCTTGCGGGCCCTCTACGAAGGCATGGAGAAGGCCCAAGAGCTCAAGGGCGACAAGGCGGTTCCCAGCAAGACG
ACGTCTACCCAGCATCGACATCTCGAGGTCGCTAGCGAGACGCTGGACCACGTATTAGCTGGCTTTGATACCTCC
GGCGTCGCCTTGGGCTTTCTCATCTGGCAGCTGTCTCAGGACCCGGACCTTCAAGACAAGCTTCGAGCTGAACTC
CTCACCGTCAAGGCGCCAAGTCTAGACGTCCTCCCCGAGTCCAGGGACCTTGACAACCTGCCTCTTCTACACGCT
GTCATCATGGAGACTCTCCGACGTCACCCTCCGATCCCCGGTTCCCAGCCGCGCATAACTCCATATCCGTCCAGC
AAGATTGCCGGTTACCAAGTGCCGGGGGGGGTCCGGATCTCGGCCATGGCCGGACCTCTGCATCTCGACGAGACT
GTCTACCCGGATCCGCTTCGATGGGACCATACGAGGTGGCTTCCCGGCGTGAAGTCCGGGGGAGAAATGAAACAG
ATGAATCGCAACTTCTGGGCATTCGGGAGCGGTGGGAGGATGTGCCTGGGCAGTAACTTTGCCTGGAATAGTCTC
AACCAAGTCACCTACTTGATCTACTCGAATTTCCGCACCTCGCTCGTTGGTCATAGTTCGATGGAGCAGATGGAC
GCCTTTGTTGGCCGCCCGAAGGGTGAGAAGCTGAATGTGAAGCTTACACCCATCGGATCTTGA
Gene >Ophcf2|06955
ATGCTCATCCTTCTTCTCGCCGCCCTGGCCGCGGCTTACGGGTTCTATTCATACCTTCTTTCCCCCCTGTTCTTC
TCCCCCCTCTCACGGATTCCTGCCCCGCATTGGTCATGCGCCATTTCGAGTTTCTGGATCCTCCGGGCTCGAAAG
CAGTTCAAAGAGAACAAGACGCTCAGTGACGCCCATTCTCGTCATGGCCCCATCGTCAGGGTCGGCCCCAATACC
CTCAGCGTCGACAGCGTCGATGCCATCAGGACCATCTACCAGGGAGGCTTCGACAAGTGGTCGTGGTATTCCGTC
TTTGACTTTTACGGCGTGCCCTGCGTCTTCTCCTCTCTCGGCTCTCACGAGCACGGGCGGAGGAAACGCATCGTC
TCGCGCGTCTACTCCAAGTCATATATCCAGTCGTCGCCTGCCGTCAGAGCCCAGGGCAGGGCCATTCTTCTGGGC
CGACTTCTCCCTCTGCTTCGACGGGAAGCTGCCCGTTCGGAGGGAATCGAGATGCAGTCCATCATCCTGTCGACG
ACCATGGACCTCATCTGTGCCTTTAACTTCGGAGTGCAAGCCGGGACAAACTTCCTCGAGGACCACGAGTCCGGC
CGGCATTGGTTCGACCTCTACGGCTACAGATTTCTTCATTTCTTCTGGCCTCAAGAGTTTCCAGCCTTTACGTCT
CTTTGCTCCAAGCTCGGATTCCGGCTTTATCCCTCCTCCGTCGACGAGGCGCACCAGGAAATCGAGGATTGGAAC
AAGCGCATGTGTGACGAGGCTCGAGATGTACTCGCTCGAGAAAAGTCGGATCTCCCTCCTCAGGATGAACCTATC
GTCTTGCGGGCCCTCTACGAAGGCATGGAGAAGGCCCAAGAGCTCAAGGGCGACAAGGCGGTTCCCAGCAAGACG
ACGTCTACCCAGCATCGACATCTCGAGGTCGCTAGCGAGACGCTGGACCACGTATTAGCTGGCTTTGATACCTCC
GGCGTCGCCTTGGGCTTTCTCATCTGGCAGCTGTCTCAGGACCCGGACCTTCAAGACAAGCTTCGAGCTGAACTC
CTCACCGTCAAGGCGCCAAGTCTAGACGTCCTCCCCGAGTCCAGGGACCTTGACAACCTGCCTCTTCTACACGCT
GTCATCATGGAGACTCTCCGACGTCACCCTCCGATCCCCGGTTCCCAGCCGCGCATAACTCCATATCCGTCCAGC
AAGATTGCCGGTTACCAAGTGCCGGGGGGGGTCCGGATCTCGGCCATGGCCGGACCTCTGCATCTCGACGAGACT
GTCTACCCGGATCCGCTTCGATGGGACCATACGAGGTGGCTTCCCGGCGTGAAGTCCGGGGGAGAAATGAAACAG
ATGAATCGCAACTTCTGGGCATTCGGGAGCGGTGGGAGGATGTGCCTGGGCAGTAACTTTGCCTGGAATAGTACG
TCGGCTACTGCAAACAAGATGAATGTGCTGACGCAACATCAGGTCTCAACCAAGTCACCTACTTGATCTACTCGA
ATTTCCGCACCTCGCTCGTTGGTCATAGTTCGATGGAGCAGATGGACGCCTTTGTTGGCCGCCCGAAGGGTGAGA
AGCTGAATGTGAAGCTTACACCCATCGGATCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail