Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06954
Gene name
Locationscaffold_09:125330..126763
Strand+
Gene length (bp)1433
Transcript length (bp)1377
Coding sequence length (bp)1377
Protein length (aa) 459

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.1844 0.1099 0.8539 0.1042 0.095 0.1223 0.2661 0.2266 0.1755 0.0033

SignalP

SignalP signal predicted Location Score
Yes 1 - 18 0.999732

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 0.00 0.00 0.00
Alive In ants, during behavior modification 5.31 1.28 9.35
Dead In ants, recently dead 3.10 0.66 5.54

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.058840 no
Dead Fungus 0.000238 yes

Orthologs

Orthofinder run ID4
Orthogroup6546
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|06954 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|484
Ophiocordyceps kimflemingae Ophio5|5546
Ophiocordyceps subramaniannii Hirsu2|20

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06954
MTNNLYTGLVALFSTVSALSSPWEDACFGDMKYLFRDNIREVCYGFAKGNMTEVGLEKLCRIEGGRFNLDKCSAT
MTILSANCGTKLQAIVRSCQLRYPELKHPYCVDDVCYREMTHHLEGSIEKACDKMLDDGTALRRYTQSLNGGCGR
SMAAVKSVCNCVRPAETTMTYSEKRCLEGMQSQFGAGTGVMCHRLMTESTFWENYNIFLFDICGQDRETIRTACQ
WDNKLLGFDKCLEKSCYRGLAQTYDHGQISDTCSAVIDRSFTQRQLNALPKLAMQCGGSLEELRSACFCVYPAER
YPHCGADDCFRGIASDWGEDIEANCRTVLSRNFTDGSEPECRNELESLVQESKWLGLQTHAFDQCGGSSEESQQC
FDHQLYCCHDYKLCGHQRREDDKLYVEAEIDGSWSAAVRLEGEISDEDLEGDGDFSEGFYGRDERCLVYNCGGFQ
WRVYGLTA*
Coding >Ophcf2|06954
ATGACGAATAATCTCTACACTGGGCTCGTGGCCCTCTTCAGCACCGTCTCAGCCCTCTCTTCCCCCTGGGAGGAT
GCATGCTTCGGCGACATGAAATACCTCTTCAGGGACAACATCAGAGAGGTGTGCTACGGTTTCGCAAAGGGCAAC
ATGACAGAGGTAGGGCTCGAGAAACTCTGCAGAATCGAGGGCGGGAGATTCAACCTGGATAAATGTTCGGCTACC
ATGACCATCTTGTCAGCCAACTGCGGCACAAAGCTTCAAGCCATCGTAAGAAGCTGCCAGCTTCGATACCCCGAG
CTGAAGCATCCGTACTGCGTCGACGATGTCTGCTACCGGGAGATGACGCATCACTTGGAGGGTTCCATCGAAAAG
GCATGTGACAAGATGCTGGACGATGGCACCGCTCTTCGGCGTTACACGCAGTCTCTCAACGGTGGATGCGGGAGG
AGCATGGCGGCAGTCAAGTCAGTCTGCAACTGCGTGCGTCCAGCAGAAACGACAATGACGTACAGCGAGAAGCGA
TGTCTCGAAGGAATGCAGAGCCAGTTTGGCGCGGGAACGGGCGTAATGTGTCATCGACTCATGACAGAAAGCACC
TTTTGGGAAAACTACAACATCTTCCTCTTCGACATCTGCGGTCAAGACCGGGAGACGATCAGAACAGCCTGCCAG
TGGGACAACAAACTCCTCGGCTTCGACAAGTGTCTGGAGAAGAGCTGCTACCGCGGTCTGGCCCAGACGTATGAC
CATGGTCAGATATCGGATACTTGCAGTGCCGTCATCGACCGCTCCTTTACGCAGAGACAGCTCAACGCCTTGCCC
AAGCTGGCGATGCAGTGCGGAGGAAGCCTCGAGGAGCTTAGATCGGCTTGCTTCTGCGTCTATCCTGCTGAGCGG
TATCCTCACTGCGGTGCGGACGATTGCTTCAGGGGCATTGCTTCAGATTGGGGGGAGGATATCGAGGCGAACTGC
CGGACTGTTCTTAGCCGCAACTTCACCGATGGCTCCGAGCCCGAGTGCAGGAACGAGCTCGAGAGCCTGGTTCAG
GAGTCCAAGTGGCTGGGACTACAGACGCATGCCTTTGATCAGTGCGGAGGGTCCAGCGAGGAATCTCAGCAGTGT
TTTGACCACCAGCTCTACTGCTGCCACGACTACAAGCTCTGCGGTCACCAGCGCCGCGAGGATGACAAGCTCTAC
GTGGAGGCCGAGATCGACGGCTCCTGGTCGGCGGCCGTACGGCTCGAGGGGGAAATCTCGGACGAGGACTTGGAG
GGAGATGGCGACTTCTCGGAAGGCTTCTACGGTAGAGACGAGCGCTGTTTGGTCTACAACTGTGGTGGCTTCCAA
TGGAGAGTCTACGGCCTCACAGCATAG
Transcript >Ophcf2|06954
ATGACGAATAATCTCTACACTGGGCTCGTGGCCCTCTTCAGCACCGTCTCAGCCCTCTCTTCCCCCTGGGAGGAT
GCATGCTTCGGCGACATGAAATACCTCTTCAGGGACAACATCAGAGAGGTGTGCTACGGTTTCGCAAAGGGCAAC
ATGACAGAGGTAGGGCTCGAGAAACTCTGCAGAATCGAGGGCGGGAGATTCAACCTGGATAAATGTTCGGCTACC
ATGACCATCTTGTCAGCCAACTGCGGCACAAAGCTTCAAGCCATCGTAAGAAGCTGCCAGCTTCGATACCCCGAG
CTGAAGCATCCGTACTGCGTCGACGATGTCTGCTACCGGGAGATGACGCATCACTTGGAGGGTTCCATCGAAAAG
GCATGTGACAAGATGCTGGACGATGGCACCGCTCTTCGGCGTTACACGCAGTCTCTCAACGGTGGATGCGGGAGG
AGCATGGCGGCAGTCAAGTCAGTCTGCAACTGCGTGCGTCCAGCAGAAACGACAATGACGTACAGCGAGAAGCGA
TGTCTCGAAGGAATGCAGAGCCAGTTTGGCGCGGGAACGGGCGTAATGTGTCATCGACTCATGACAGAAAGCACC
TTTTGGGAAAACTACAACATCTTCCTCTTCGACATCTGCGGTCAAGACCGGGAGACGATCAGAACAGCCTGCCAG
TGGGACAACAAACTCCTCGGCTTCGACAAGTGTCTGGAGAAGAGCTGCTACCGCGGTCTGGCCCAGACGTATGAC
CATGGTCAGATATCGGATACTTGCAGTGCCGTCATCGACCGCTCCTTTACGCAGAGACAGCTCAACGCCTTGCCC
AAGCTGGCGATGCAGTGCGGAGGAAGCCTCGAGGAGCTTAGATCGGCTTGCTTCTGCGTCTATCCTGCTGAGCGG
TATCCTCACTGCGGTGCGGACGATTGCTTCAGGGGCATTGCTTCAGATTGGGGGGAGGATATCGAGGCGAACTGC
CGGACTGTTCTTAGCCGCAACTTCACCGATGGCTCCGAGCCCGAGTGCAGGAACGAGCTCGAGAGCCTGGTTCAG
GAGTCCAAGTGGCTGGGACTACAGACGCATGCCTTTGATCAGTGCGGAGGGTCCAGCGAGGAATCTCAGCAGTGT
TTTGACCACCAGCTCTACTGCTGCCACGACTACAAGCTCTGCGGTCACCAGCGCCGCGAGGATGACAAGCTCTAC
GTGGAGGCCGAGATCGACGGCTCCTGGTCGGCGGCCGTACGGCTCGAGGGGGAAATCTCGGACGAGGACTTGGAG
GGAGATGGCGACTTCTCGGAAGGCTTCTACGGTAGAGACGAGCGCTGTTTGGTCTACAACTGTGGTGGCTTCCAA
TGGAGAGTCTACGGCCTCACAGCATAG
Gene >Ophcf2|06954
ATGACGAATAATCTCTACACTGGGCTCGTGGCCCTCTTCAGCACCGTCTCAGCCCTCTCTTCCCCCTGGGAGGAT
GCATGCTTCGGCGACATGAAATACCTCTTCAGGGACAACATCAGAGAGGTGTGCTACGGTTTCGCAAAGGGCAAC
ATGACAGAGGTAGGGCTCGAGAAACTCTGCAGAATCGAGGGCGGGAGATTCAACCTGGATAAATGTTCGGCTACC
ATGACCATCTTGTCAGCCAACTGCGGCACAAAGCTTCAAGCCATCGTAAGAAGCTGCCAGCTTCGATACCCCGAG
CTGAAGCATCCGTACTGCGTCGACGATGTCTGCTACCGGGAGATGACGCATCACTTGGAGGGTTCCATCGAAAAG
GCATGTGACAAGATGCTGGACGATGGCACCGCTCTTCGGCGTTACACGCAGTCTCTCAACGGTGGATGCGGGAGG
AGCATGGCGGCAGTCAAGTCAGTCTGCAACTGCGTGCGTCCAGCAGAAACGACAATGACGTACAGCGAGAAGCGA
TGTCTCGAAGGAATGCAGAGCCAGTTTGGCGCGGGAACGGGCGTAATGTGTCATCGACTCATGACAGAAAGCACC
TTTTGGGAAAACTACAACATCTTCCTCTTCGACATCTGCGGTCAAGACCGGGAGACGATCAGAACAGCCTGCCAG
TGGGACAACAAACTCCTCGGCTTCGACAAGTGTCTGGAGAAGAGCTGCTACCGCGGTCTGGCCCAGACGTATGAC
CATGGTCAGATATCGGATACTTGCAGTGCCGTCATCGACCGCTCCTTTACGCAGAGACAGCTCAACGCCTTGCCC
AAGCTGGCGATGCAGTGCGGAGGAAGCCTCGAGGAGCTTAGATCGGCTTGCTTCTGCGTCTATCCTGCTGAGCGG
TATCCTCACTGCGGTGCGGACGATTGCTTCAGGGGCATTGCTTCAGATTGGGGGGAGGATATCGAGGCGAACTGC
CGGACTGTTCTTAGCCGCAACTTCACCGATGGCTCCGAGCCCGAGTGCAGGAACGAGCTCGAGAGCCTGGTTCAG
GAGTCCAAGTGGCTGGGACTACAGACGCATGCCTTTGATCAGTGCGGTAAGGACCAGGCGAAGCTGCAAAAGGCC
TGTCGATGTGTCTTGCCCGATGTTGAGGAGGGTCCAGCGAGGAATCTCAGCAGTGTTTTGACCACCAGCTCTACT
GCTGCCACGACTACAAGCTCTGCGGTCACCAGCGCCGCGAGGATGACAAGCTCTACGTGGAGGCCGAGATCGACG
GCTCCTGGTCGGCGGCCGTACGGCTCGAGGGGGAAATCTCGGACGAGGACTTGGAGGGAGATGGCGACTTCTCGG
AAGGCTTCTACGGTAGAGACGAGCGCTGTTTGGTCTACAACTGTGGTGGCTTCCAATGGAGAGTCTACGGCCTCA
CAGCATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail