Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06952
Gene name
Locationscaffold_09:112949..114831
Strand+
Gene length (bp)1882
Transcript length (bp)1593
Coding sequence length (bp)1593
Protein length (aa) 531

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13520 AA_permease_2 Amino acid permease 1.2E-44 58 505
PF00324 AA_permease Amino acid permease 1.1E-25 63 519

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0016020 membrane Yes
GO:0055085 transmembrane transport Yes
GO:0005575 cellular_component No
GO:0051179 localization No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0110165 cellular anatomical entity No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.45

Transmembrane Domains

Domain # Start End Length
1 59 81 22
2 91 110 19
3 144 166 22
4 186 205 19
5 217 236 19
6 256 275 19
7 296 318 22
8 342 364 22
9 396 418 22
10 428 450 22
11 457 479 22
12 494 516 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06952
MGALDPERAPAGSKLGHVDSKQQFEGPPPRPSTTGDVDADQLLQNLGYKSELVRSRSTLHVAFMSFVLAAIPYGL
ATTFSFPLVAGGPVDIFWGWLLVSVIALCTAASLGEITSIYPTAGGVYYQAFMLAPPEYRRISSWICGWLFVVGN
VTITLSVNFGTSLFLVSCINVFEKAPGVGVLEGSPYQVFLIFIGLTVVSNVVSALGNRWLPVLDTAAVYWTFAGT
IAIMITVLAVARNGRRSASFAFTHFEANSGWPSGWSFFVGLLHAGYATSSTGMVISMCEEVQKPSVQVPKALVYT
IFLNTVAGCIFLLPLVFVLPDIKNLISISAGQPVPFIVKDAVGSSAGAFCLLIPILVLGVICGIGCTTASSRCAW
AFARDGAIPGSKWWMKVNRRLDVPLNAMMLSAAVQIILGLIYFGSTAAFGAFTGVGVICLTASYAVPIAISLLSG
RKQVRTGSFYLGPLGTVCNVVAILWSLLALPLFCMPLNVPVTATTANYAPAVFVVATTVSTVWYWVWGHKNYAGP
PVQGE*
Coding >Ophcf2|06952
ATGGGCGCCCTTGACCCCGAACGAGCCCCCGCCGGCTCCAAGCTCGGCCATGTCGACTCCAAGCAGCAGTTCGAA
GGCCCGCCTCCCCGACCGTCGACGACGGGCGATGTGGACGCCGACCAGCTCCTCCAGAACCTCGGTTACAAGTCG
GAGCTCGTCCGCTCTCGCTCGACGCTACATGTGGCTTTCATGTCCTTCGTCCTGGCTGCCATCCCCTACGGCCTC
GCCACCACCTTCAGTTTCCCGCTCGTCGCAGGTGGCCCCGTCGACATCTTCTGGGGCTGGCTGCTCGTCTCCGTC
ATCGCCCTCTGCACGGCCGCCTCGCTCGGCGAAATCACCAGCATCTATCCCACTGCCGGAGGCGTCTACTACCAG
GCCTTTATGCTCGCGCCCCCGGAATACCGCCGCATCTCCAGTTGGATATGTGGTTGGCTGTTCGTCGTCGGAAAC
GTCACCATTACCCTGTCGGTCAACTTTGGCACCAGCCTCTTCCTCGTCTCGTGCATCAACGTCTTTGAAAAGGCA
CCCGGTGTCGGCGTCTTGGAGGGCTCCCCTTATCAAGTGTTTCTGATCTTTATCGGCCTCACCGTCGTGTCCAAT
GTCGTCTCCGCTCTCGGTAACCGATGGCTGCCTGTCCTCGACACGGCTGCTGTGTACTGGACCTTTGCCGGCACC
ATTGCCATCATGATTACCGTCCTCGCCGTCGCCCGCAACGGCCGCCGGAGTGCCAGTTTTGCCTTTACCCATTTC
GAGGCCAACTCGGGATGGCCGAGCGGGTGGTCCTTTTTCGTCGGTCTGCTTCACGCTGGCTACGCCACGTCGTCT
ACCGGCATGGTCATCTCCATGTGCGAGGAGGTGCAGAAGCCGTCTGTCCAGGTGCCCAAGGCGCTGGTGTACACA
ATCTTTCTCAACACGGTGGCGGGCTGCATATTCCTTCTCCCCCTCGTCTTCGTCCTTCCGGACATCAAGAACCTC
ATCAGCATATCGGCGGGCCAGCCGGTGCCCTTCATCGTCAAGGATGCCGTCGGTTCTTCTGCCGGCGCCTTTTGC
CTACTCATCCCCATCCTCGTCCTCGGTGTCATCTGCGGCATCGGATGCACGACGGCCTCGTCGCGTTGCGCCTGG
GCCTTTGCCCGCGACGGCGCCATTCCCGGCTCCAAGTGGTGGATGAAGGTCAATCGTCGACTCGACGTGCCCCTC
AACGCCATGATGCTGAGCGCGGCCGTGCAAATCATCCTCGGTCTCATCTACTTTGGCTCCACGGCTGCCTTTGGT
GCCTTTACTGGCGTCGGTGTCATCTGCCTGACCGCCTCGTACGCCGTGCCAATTGCCATCAGCTTGTTGTCGGGG
AGGAAGCAGGTTAGGACTGGTTCTTTCTACCTCGGACCTCTGGGGACCGTCTGCAACGTCGTTGCCATCCTATGG
AGTCTGCTGGCGTTGCCCTTGTTCTGCATGCCGTTGAACGTGCCCGTCACGGCGACGACAGCCAACTACGCGCCA
GCCGTCTTTGTCGTCGCCACGACCGTCTCGACCGTCTGGTACTGGGTCTGGGGCCATAAGAACTACGCCGGCCCT
CCCGTACAAGGGGAGTGA
Transcript >Ophcf2|06952
ATGGGCGCCCTTGACCCCGAACGAGCCCCCGCCGGCTCCAAGCTCGGCCATGTCGACTCCAAGCAGCAGTTCGAA
GGCCCGCCTCCCCGACCGTCGACGACGGGCGATGTGGACGCCGACCAGCTCCTCCAGAACCTCGGTTACAAGTCG
GAGCTCGTCCGCTCTCGCTCGACGCTACATGTGGCTTTCATGTCCTTCGTCCTGGCTGCCATCCCCTACGGCCTC
GCCACCACCTTCAGTTTCCCGCTCGTCGCAGGTGGCCCCGTCGACATCTTCTGGGGCTGGCTGCTCGTCTCCGTC
ATCGCCCTCTGCACGGCCGCCTCGCTCGGCGAAATCACCAGCATCTATCCCACTGCCGGAGGCGTCTACTACCAG
GCCTTTATGCTCGCGCCCCCGGAATACCGCCGCATCTCCAGTTGGATATGTGGTTGGCTGTTCGTCGTCGGAAAC
GTCACCATTACCCTGTCGGTCAACTTTGGCACCAGCCTCTTCCTCGTCTCGTGCATCAACGTCTTTGAAAAGGCA
CCCGGTGTCGGCGTCTTGGAGGGCTCCCCTTATCAAGTGTTTCTGATCTTTATCGGCCTCACCGTCGTGTCCAAT
GTCGTCTCCGCTCTCGGTAACCGATGGCTGCCTGTCCTCGACACGGCTGCTGTGTACTGGACCTTTGCCGGCACC
ATTGCCATCATGATTACCGTCCTCGCCGTCGCCCGCAACGGCCGCCGGAGTGCCAGTTTTGCCTTTACCCATTTC
GAGGCCAACTCGGGATGGCCGAGCGGGTGGTCCTTTTTCGTCGGTCTGCTTCACGCTGGCTACGCCACGTCGTCT
ACCGGCATGGTCATCTCCATGTGCGAGGAGGTGCAGAAGCCGTCTGTCCAGGTGCCCAAGGCGCTGGTGTACACA
ATCTTTCTCAACACGGTGGCGGGCTGCATATTCCTTCTCCCCCTCGTCTTCGTCCTTCCGGACATCAAGAACCTC
ATCAGCATATCGGCGGGCCAGCCGGTGCCCTTCATCGTCAAGGATGCCGTCGGTTCTTCTGCCGGCGCCTTTTGC
CTACTCATCCCCATCCTCGTCCTCGGTGTCATCTGCGGCATCGGATGCACGACGGCCTCGTCGCGTTGCGCCTGG
GCCTTTGCCCGCGACGGCGCCATTCCCGGCTCCAAGTGGTGGATGAAGGTCAATCGTCGACTCGACGTGCCCCTC
AACGCCATGATGCTGAGCGCGGCCGTGCAAATCATCCTCGGTCTCATCTACTTTGGCTCCACGGCTGCCTTTGGT
GCCTTTACTGGCGTCGGTGTCATCTGCCTGACCGCCTCGTACGCCGTGCCAATTGCCATCAGCTTGTTGTCGGGG
AGGAAGCAGGTTAGGACTGGTTCTTTCTACCTCGGACCTCTGGGGACCGTCTGCAACGTCGTTGCCATCCTATGG
AGTCTGCTGGCGTTGCCCTTGTTCTGCATGCCGTTGAACGTGCCCGTCACGGCGACGACAGCCAACTACGCGCCA
GCCGTCTTTGTCGTCGCCACGACCGTCTCGACCGTCTGGTACTGGGTCTGGGGCCATAAGAACTACGCCGGCCCT
CCCGTACAAGGGGAGTGA
Gene >Ophcf2|06952
ATGGGCGCCCTTGACCCCGAACGAGCCCCCGCCGGCTCCAAGCTCGGCCATGTCGACTCCAAGCAGCAGTTCGAA
GGCCCGCCTCCCCGACCGTCGACGACGGGCGATGTGGACGCCGACCAGCTCCTCCAGAACCTCGGTTACAAGTCG
GAGCTCGTCCGCTCTCGCTCGACGCTACATGTGGCTTTCATGTCCTTCGTCCTGGCTGCCATCCCCTACGGCCTC
GCCACCACCTTCAGTTTCCCGCTCGTCGCAGGTGGCCCCGTCGACATCTTCTGGGGCTGGCTGCTCGTCTCCGTC
ATCGCCCTCTGCACGGCCGCCTCGCTCGGCGAAATCACCAGCATCTATCCCACTGCCGGAGGTATATACATACAT
ACATCATCTTGCATACCTCGAGGCCACCAATGGCGCCCTCTTGGCCACGCCCTCTTTCCTCCCTCTCTTCGCGCT
CACTTGATTGATGGTTCTTCTCCGTCGCAGGCGTCTACTACCAGGCCTTTATGCTCGCGCCCCCGGAATACCGCC
GCATCTCCAGTTGGATATGTGGTTGGCTGTTCGTCGTCGGAAACGTCACCATTACCCTGTCGGTCAACTTTGGCA
CCAGCCTCTTCCTCGTCTCGTGCATCAACGTCTTTGAAAAGGCACCCGGTGTCGGCGTCTTGGAGGGCTCCCCTT
ATCAAGTGTTTCTGATCTTTATCGGCCTCACCGTCGTGTCCAATGTCGTCTCCGCTCTCGGTAACCGATGGCTGC
CTGTCCTCGACGTGAGCTCCCTCAATCTCTCTCTTGGGCATCTCCTTTCCCCGCCTTGCTGACGATTGCCCAGAC
GGCTGCTGTGTACTGGACCTTTGCCGGCACCATTGCCATCATGATTACCGTCCTCGCCGTCGCCCGCAACGGCCG
CCGGAGTGCCAGTTTTGCCTTTACCCATTTCGAGGCCAACTCGGGATGGCCGAGCGGGTGGTCCTTTTTCGTCGG
TCTGCTTCACGCTGGCTACGCCACGTCGTCTACCGGCATGGTCATCTCGTGAGCCCTGTCTCCCTCGTGCGTCCG
CTCATGGCACTGACTTGTGTGGCAAAAAGCATGTGCGAGGAGGTGCAGAAGCCGTCTGTCCAGGTGCCCAAGGCG
CTGGTGTACACAATCTTTCTCAACACGGTGGCGGGCTGCATATTCCTTCTCCCCCTCGTCTTCGTCCTTCCGGAC
ATCAAGAACCTCATCAGCATATCGGCGGGCCAGCCGGTGCCCTTCATCGTCAAGGATGCCGTCGGTTCTTCTGCC
GGCGCCTTTTGCCTACTCATCCCCATCCTCGTCCTCGGTGTCATCTGCGGCATCGGATGCACGACGGCCTCGTCG
CGTTGCGCCTGGGCCTTTGCCCGCGACGGCGCCATTCCCGGCTCCAAGTGGTGGATGAAGGTCAATCGTCGACTC
GACGTGCCCCTCAACGCCATGATGCTGAGCGCGGCCGTGCAAATCATCCTCGGTCTCATCTACTTTGGCTCCACG
GCTGCCTTTGGTGCCTTTACTGGCGTCGGTGTCATCTGCCTGACCGCCTCGTACGCCGTGCCAATTGCCATCAGC
TTGTTGTCGGGGAGGAAGCAGGTTAGGACTGGTTCTTTCTACCTCGGACCTCTGGGGACCGTCTGCAACGTCGTT
GCCATCCGTAAGTGACCGCCGCGTTGCTTCCCTCCTTCGCACCGACTGACCGCGTCAAGTATGGAGTCTGCTGGC
GTTGCCCTTGTTCTGCATGCCGTTGAACGTGCCCGTCACGGCGACGACAGCCAACTACGCGCCAGCCGTCTTTGT
CGTCGCCACGACCGTCTCGACCGTCTGGTACTGGGTCTGGGGCCATAAGAACTACGCCGGCCCTCCCGTACAAGG
GGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail