Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06948
Gene name
Locationscaffold_09:77134..78974
Strand-
Gene length (bp)1840
Transcript length (bp)1575
Coding sequence length (bp)1575
Protein length (aa) 525

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00083 Sugar_tr Sugar (and other) transporter 5.7E-80 53 503
PF07690 MFS_1 Major Facilitator Superfamily 6.2E-18 58 328
PF07690 MFS_1 Major Facilitator Superfamily 6.3E-11 305 493

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0016021 integral component of membrane Yes
GO:0005575 cellular_component No
GO:0051179 localization No
GO:0008150 biological_process No
GO:0031224 intrinsic component of membrane No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0110165 cellular anatomical entity No
GO:0051234 establishment of localization No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cell membrane 0.0753 0.1749 0.1204 0.4658 0.0364 0.0012 0.1702 0.241 0.2013 0.0026

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 50 72 22
2 87 109 22
3 116 135 19
4 145 167 22
5 180 199 19
6 209 231 22
7 300 322 22
8 337 356 19
9 368 390 22
10 405 427 22
11 440 462 22
12 467 489 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 3.25 0.86 5.64
Alive In ants, during behavior modification 3.63 0.30 6.97
Dead In ants, recently dead 1.26 0.15 2.38

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.795240 no
Alive Dead 0.000657 yes
Dead Fungus 0.008044 yes

Orthologs

Orthofinder run ID4
Orthogroup1178
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7269
Ophiocordyceps australis map64 (Brazil) OphauB2|6713
Ophiocordyceps camponoti-floridani Ophcf2|06948 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|491
Ophiocordyceps subramaniannii Hirsu2|10300
Ophiocordyceps subramaniannii Hirsu2|11132

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06948
MPSDPAVEIVGEKEAREAVVEVEGDAPFSGSAAAAAPLDPFSRTSFQLYAILLVAALNATASGFDGSIFSSINAM
AQYQDYFNHKELGSATGLIFMMFTIGSMVGSLFSGPVCDNFGRRIGMAAGSVLIMTGAAIQTAARGDASLLAGRF
VLGFGVAIGTSSAPTYALELAPPQWRARIVGYYNTFFYSGSILATGVAYASSKSTGEVAFRLPLSLQLVFPLFIL
IGTAFIPESPRWLTMWGKKDEAGRILAKYHGGGNANHPLVLLELREFEANIELQKTSSVWNYWALVETHNARWRF
AMMAFMSIFAQLSGNSVLTYYLPSMYRQVGITTTERRLLLTFLNSIVSCIGAIAGSATNDRMGRRSKLWIGSFVL
AGLLGAVTGFSSQFGDASKKVGVEISNSGVAFIFLFGFAYSYVYTPLTSTYCGEVLANPTRAKGMGVHVLLGNMA
NLYNAYVTAIAFEAVGWRYYLVFVGLNLVYGVLWYVFGVETRGRTLEEMDAVFDAKFPPRAALRRPTEFQVKGS*
Coding >Ophcf2|06948
ATGCCTTCGGATCCTGCCGTCGAAATTGTCGGGGAAAAGGAGGCTCGAGAAGCCGTCGTCGAGGTCGAAGGCGAT
GCTCCATTCTCCGGTTCTGCCGCGGCTGCCGCGCCTTTAGACCCGTTCTCCAGGACGAGCTTCCAGCTTTATGCC
ATCCTGCTTGTTGCTGCGCTCAACGCGACGGCCTCTGGATTCGATGGATCCATCTTTAGTTCCATCAACGCTATG
GCGCAGTATCAAGACTACTTCAACCACAAAGAACTCGGTTCAGCCACCGGCCTAATCTTCATGATGTTCACCATC
GGAAGCATGGTCGGCTCTCTCTTCTCCGGCCCCGTCTGCGACAACTTCGGCCGCCGAATCGGCATGGCCGCCGGC
TCCGTCCTGATCATGACCGGGGCTGCCATTCAGACAGCAGCCAGAGGCGACGCCTCACTCCTCGCTGGCCGCTTT
GTCCTGGGTTTCGGCGTCGCCATTGGCACCTCGTCTGCCCCGACGTATGCGCTTGAACTTGCTCCGCCGCAGTGG
CGAGCACGCATCGTCGGCTACTACAATACCTTCTTCTACTCCGGCTCCATCCTGGCAACCGGAGTCGCCTACGCC
TCGAGTAAGTCTACAGGCGAAGTCGCCTTTCGGCTACCGCTATCTCTCCAGCTCGTCTTCCCCCTCTTCATCCTC
ATCGGAACCGCCTTCATCCCCGAGTCGCCTCGTTGGCTCACCATGTGGGGGAAAAAGGACGAAGCCGGCCGCATC
CTGGCCAAGTATCACGGAGGCGGCAATGCGAATCACCCGCTGGTCCTCCTCGAGCTGCGAGAGTTTGAAGCCAAC
ATTGAACTTCAAAAGACTTCCAGCGTCTGGAATTACTGGGCTCTCGTGGAGACACACAACGCTCGCTGGCGCTTT
GCCATGATGGCTTTCATGTCCATCTTCGCCCAGCTGTCAGGGAACTCGGTCTTGACGTACTATCTGCCATCCATG
TATAGGCAGGTTGGCATCACAACTACTGAGCGTCGCCTGCTTCTCACCTTTCTCAACTCCATCGTTTCCTGCATC
GGGGCTATTGCCGGCTCTGCGACGAACGACCGGATGGGAAGACGATCGAAGCTGTGGATTGGCAGTTTCGTCCTT
GCTGGTCTCTTGGGCGCCGTCACAGGCTTCTCCAGTCAGTTTGGCGATGCCAGCAAGAAAGTAGGAGTTGAGATT
TCCAACAGCGGCGTTGCTTTTATCTTTCTCTTCGGCTTTGCGTATTCCTACGTCTACACGCCGTTGACTAGCACC
TACTGCGGCGAGGTGTTAGCGAACCCAACTCGAGCCAAGGGAATGGGCGTGCACGTCCTCTTGGGCAACATGGCC
AACCTTTACAACGCATACGTCACGGCCATTGCGTTCGAAGCCGTTGGCTGGCGCTATTACCTCGTCTTCGTCGGT
CTCAACCTCGTGTACGGTGTTTTGTGGTACGTCTTTGGCGTCGAAACTCGGGGGAGGACGCTGGAGGAGATGGAC
GCTGTGTTTGATGCCAAGTTTCCGCCGAGGGCGGCGCTTCGGAGGCCGACTGAGTTTCAGGTGAAGGGGTCGTAG
Transcript >Ophcf2|06948
ATGCCTTCGGATCCTGCCGTCGAAATTGTCGGGGAAAAGGAGGCTCGAGAAGCCGTCGTCGAGGTCGAAGGCGAT
GCTCCATTCTCCGGTTCTGCCGCGGCTGCCGCGCCTTTAGACCCGTTCTCCAGGACGAGCTTCCAGCTTTATGCC
ATCCTGCTTGTTGCTGCGCTCAACGCGACGGCCTCTGGATTCGATGGATCCATCTTTAGTTCCATCAACGCTATG
GCGCAGTATCAAGACTACTTCAACCACAAAGAACTCGGTTCAGCCACCGGCCTAATCTTCATGATGTTCACCATC
GGAAGCATGGTCGGCTCTCTCTTCTCCGGCCCCGTCTGCGACAACTTCGGCCGCCGAATCGGCATGGCCGCCGGC
TCCGTCCTGATCATGACCGGGGCTGCCATTCAGACAGCAGCCAGAGGCGACGCCTCACTCCTCGCTGGCCGCTTT
GTCCTGGGTTTCGGCGTCGCCATTGGCACCTCGTCTGCCCCGACGTATGCGCTTGAACTTGCTCCGCCGCAGTGG
CGAGCACGCATCGTCGGCTACTACAATACCTTCTTCTACTCCGGCTCCATCCTGGCAACCGGAGTCGCCTACGCC
TCGAGTAAGTCTACAGGCGAAGTCGCCTTTCGGCTACCGCTATCTCTCCAGCTCGTCTTCCCCCTCTTCATCCTC
ATCGGAACCGCCTTCATCCCCGAGTCGCCTCGTTGGCTCACCATGTGGGGGAAAAAGGACGAAGCCGGCCGCATC
CTGGCCAAGTATCACGGAGGCGGCAATGCGAATCACCCGCTGGTCCTCCTCGAGCTGCGAGAGTTTGAAGCCAAC
ATTGAACTTCAAAAGACTTCCAGCGTCTGGAATTACTGGGCTCTCGTGGAGACACACAACGCTCGCTGGCGCTTT
GCCATGATGGCTTTCATGTCCATCTTCGCCCAGCTGTCAGGGAACTCGGTCTTGACGTACTATCTGCCATCCATG
TATAGGCAGGTTGGCATCACAACTACTGAGCGTCGCCTGCTTCTCACCTTTCTCAACTCCATCGTTTCCTGCATC
GGGGCTATTGCCGGCTCTGCGACGAACGACCGGATGGGAAGACGATCGAAGCTGTGGATTGGCAGTTTCGTCCTT
GCTGGTCTCTTGGGCGCCGTCACAGGCTTCTCCAGTCAGTTTGGCGATGCCAGCAAGAAAGTAGGAGTTGAGATT
TCCAACAGCGGCGTTGCTTTTATCTTTCTCTTCGGCTTTGCGTATTCCTACGTCTACACGCCGTTGACTAGCACC
TACTGCGGCGAGGTGTTAGCGAACCCAACTCGAGCCAAGGGAATGGGCGTGCACGTCCTCTTGGGCAACATGGCC
AACCTTTACAACGCATACGTCACGGCCATTGCGTTCGAAGCCGTTGGCTGGCGCTATTACCTCGTCTTCGTCGGT
CTCAACCTCGTGTACGGTGTTTTGTGGTACGTCTTTGGCGTCGAAACTCGGGGGAGGACGCTGGAGGAGATGGAC
GCTGTGTTTGATGCCAAGTTTCCGCCGAGGGCGGCGCTTCGGAGGCCGACTGAGTTTCAGGTGAAGGGGTCGTAG
Gene >Ophcf2|06948
ATGCCTTCGGATCCTGCCGTCGAAATTGTCGGGGAAAAGGAGGCTCGAGAAGCCGTCGTCGAGGTCGAAGGCGAT
GCTCCATTCTCCGGTTCTGCCGCGGCTGCCGCGCCTTTAGACCCGTTCTCCAGGACGAGCTTCCAGCTTTATGCC
ATCCTGCTTGTTGCTGCGCTCAACGCGACGGCCTCTGGATTCGATGGAGTGAGATTCGCCCTGTCAGCGAGTTTG
AGAGAGGTGTTGTCGTTGACGGGAATAGTCCATCTTTAGTTCCATCAACGCTATGGCGCAGTATCAAGACTACTT
CAACCACAAAGAACTCGGTTCAGCCACCGGCCTGTAAGTCTATCACTTCTCTCTGCACATTGCGTCTAACAAGCC
CCTTAGAATCTTCATGATGTTCACCATCGGAAGCATGGTCGGCTCTCTCTTCTCCGGCCCCGTCTGCGACAACTT
CGGCCGCCGAATCGGCATGGCCGCCGGCTCCGTCCTGATCATGACCGGGGCTGCCATTCAGACAGCAGCCAGAGG
CGACGCCTCACTCCTCGCTGGCCGCTTTGTCCTGGGTTTCGGCGTCGCCATTGGCACCTCGTCTGCCCCGACGTA
TGCGCTTGAACTTGCTCCGCCGCAGTGGCGAGCACGCATCGTCGGCTACTACAATACCTGTATGGCGCTTCCTCG
ATATAGAAAGCTCTCGTTACTCACTTCATACAGTCTTCTACTCCGGCTCCATCCTGGCAACCGGAGTCGCCTACG
CCTCGAGTAAGTCTACAGGCGAAGTCGCCTTTCGGCTACCGCTATCTCTCCAGCTCGTCTTCCCCCTCTTCATCC
TCATCGGAACCGCCTTCATCCCCGAGTCGCCTCGTTGGCTCACCATGTGGGGGAAAAAGGACGAAGCCGGCCGCA
TCCTGGCCAAGTATCACGGAGGCGGCAATGCGAATCACCCGCTGGTCCTCCTCGAGCTGCGAGAGTTTGAAGCCA
ACATTGAACTTCAAAAGACTTCCAGCGTCTGGAATTACTGGGCTCTCGTGGAGACACACAACGCTCGCTGGCGCT
TTGCCATGATGGCTTTCATGTCCATCTTCGCCCAGCTGTCAGGGAACTCGGTCTTGACGTACTATCTGCCATCCA
TGTATAGGCAGGTTGGCATCACAACTACTGAGCGTCGCCTGCTTCTCACCTTTCTCAACTCCATCGTTTCCTGCA
TCGGGGCTATTGCCGGCTCTGCGACGAACGACCGGATGGGAAGACGATCGAAGCTGTGGATTGGCAGTTTCGTCC
TTGCTGGTCTCTTGGGCGCCGTCACAGGCTTCTCCAGTCAGTTTGGCGATGCCAGCAAGAAAGTAGGAGTTGAGA
TTTCCAACAGCGGCGTTGCTTTTGTGAGAGAAACTACGATTCTTGACTTGAAGACAGCAGCTTACGATCAACTTC
ATGACGCAGATCTTTCTCTTCGGCTTTGCGTATTCCTACGTCTACACGCCGTTGACTAGCACCTACTGCGGCGAG
GTGTTAGCGAACCCAACTCGAGCCAAGGGAATGGGCGTGGTAAGTCGAGCTCGAAGCCTTCGCAACGCACTCAAC
TCATCATCTCACCCAGCACGTCCTCTTGGGCAACATGGCCAACCTTTACAACGCATACGTCACGGCCATTGCGTT
CGAAGCCGTTGGCTGGCGCTATTACCTCGTCTTCGTCGGTCTCAACCTCGTGTACGGTGTTTTGTGGTACGTCTT
TGGCGTCGAAACTCGGGGGAGGACGCTGGAGGAGATGGACGCTGTGTTTGATGCCAAGTTTCCGCCGAGGGCGGC
GCTTCGGAGGCCGACTGAGTTTCAGGTGAAGGGGTCGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail