Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06947
Gene name
Locationscaffold_09:75528..76707
Strand+
Gene length (bp)1179
Transcript length (bp)849
Coding sequence length (bp)849
Protein length (aa) 283

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05875 Ceramidase Ceramidase 6.4E-77 15 263

GO

GO Term Description Terminal node
GO:0006672 ceramide metabolic process Yes
GO:0016021 integral component of membrane Yes
GO:0016811 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides Yes
GO:0003824 catalytic activity No
GO:0044237 cellular metabolic process No
GO:0110165 cellular anatomical entity No
GO:0006643 membrane lipid metabolic process No
GO:0009987 cellular process No
GO:1901564 organonitrogen compound metabolic process No
GO:0008152 metabolic process No
GO:0006665 sphingolipid metabolic process No
GO:0044255 cellular lipid metabolic process No
GO:0031224 intrinsic component of membrane No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0005575 cellular_component No
GO:0006807 nitrogen compound metabolic process No
GO:0006629 lipid metabolic process No
GO:0016787 hydrolase activity No
GO:0003674 molecular_function No
GO:0016810 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds No
GO:0043603 cellular amide metabolic process No
GO:0008150 biological_process No
GO:0034641 cellular nitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 32 54 22
2 67 86 19
3 109 131 22
4 143 165 22
5 180 198 18
6 219 241 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06947
MDALETPAVLPFWSAPTSYLNFCEEDYALTRYIAEFINTLSSLSYVAYGIYGLSSNGKRPQSASRVASYCGLMGV
GICSAGYHMTLKYHTQMLDELSMHLLATPILYRLLTLGAGPYYTKVVGVTLLVLFIIVMTTHMLMDEFLLHATTF
GLAVYLIASRIWQIIPQRVPDSQIRKKLQTLTKFGCVNFLGGYFLWLVDEWACGLLTKMRHSVGMPVAFFLELHG
WWHILTAIGGYIAVAIVDVLTSTSGEVVEDPIPSFAWPIPQALQILSGTARVKNHGK*
Coding >Ophcf2|06947
ATGGACGCTCTGGAGACGCCGGCTGTCTTACCCTTCTGGAGCGCGCCGACGTCGTATCTCAACTTCTGTGAAGAG
GATTATGCGCTTACGCGGTATATTGCCGAGTTTATCAATACCCTCAGCAGTCTCTCCTACGTCGCCTATGGAATC
TATGGTCTGTCCAGCAACGGGAAGAGGCCTCAGTCGGCGTCTCGCGTGGCCTCGTACTGCGGCCTGATGGGGGTG
GGCATCTGCTCGGCCGGATACCACATGACGCTCAAGTATCACACTCAGATGCTGGACGAGCTGTCGATGCATCTC
CTCGCCACCCCGATCCTCTACCGCCTGCTCACCCTAGGAGCTGGGCCATACTATACAAAGGTGGTGGGAGTGACG
CTGCTGGTGCTCTTCATCATCGTCATGACGACGCACATGCTCATGGACGAGTTTCTTCTCCATGCCACGACGTTT
GGCCTCGCCGTCTACCTGATTGCCTCGCGCATCTGGCAGATTATCCCGCAGAGGGTGCCGGATTCCCAGATTAGG
AAGAAGCTGCAGACTTTGACCAAGTTTGGCTGCGTGAATTTCCTCGGGGGGTATTTTCTTTGGCTGGTTGATGAG
TGGGCTTGTGGGCTTCTCACCAAGATGAGGCATTCTGTTGGGATGCCTGTTGCCTTTTTTCTCGAGTTGCATGGT
TGGTGGCATATCCTGACTGCCATTGGCGGCTACATCGCCGTCGCCATCGTCGACGTCTTGACGTCTACGTCTGGG
GAGGTGGTCGAAGATCCCATCCCTTCATTTGCCTGGCCGATTCCGCAGGCGTTGCAGATTCTATCGGGGACTGCC
AGGGTCAAGAATCATGGCAAGTGA
Transcript >Ophcf2|06947
ATGGACGCTCTGGAGACGCCGGCTGTCTTACCCTTCTGGAGCGCGCCGACGTCGTATCTCAACTTCTGTGAAGAG
GATTATGCGCTTACGCGGTATATTGCCGAGTTTATCAATACCCTCAGCAGTCTCTCCTACGTCGCCTATGGAATC
TATGGTCTGTCCAGCAACGGGAAGAGGCCTCAGTCGGCGTCTCGCGTGGCCTCGTACTGCGGCCTGATGGGGGTG
GGCATCTGCTCGGCCGGATACCACATGACGCTCAAGTATCACACTCAGATGCTGGACGAGCTGTCGATGCATCTC
CTCGCCACCCCGATCCTCTACCGCCTGCTCACCCTAGGAGCTGGGCCATACTATACAAAGGTGGTGGGAGTGACG
CTGCTGGTGCTCTTCATCATCGTCATGACGACGCACATGCTCATGGACGAGTTTCTTCTCCATGCCACGACGTTT
GGCCTCGCCGTCTACCTGATTGCCTCGCGCATCTGGCAGATTATCCCGCAGAGGGTGCCGGATTCCCAGATTAGG
AAGAAGCTGCAGACTTTGACCAAGTTTGGCTGCGTGAATTTCCTCGGGGGGTATTTTCTTTGGCTGGTTGATGAG
TGGGCTTGTGGGCTTCTCACCAAGATGAGGCATTCTGTTGGGATGCCTGTTGCCTTTTTTCTCGAGTTGCATGGT
TGGTGGCATATCCTGACTGCCATTGGCGGCTACATCGCCGTCGCCATCGTCGACGTCTTGACGTCTACGTCTGGG
GAGGTGGTCGAAGATCCCATCCCTTCATTTGCCTGGCCGATTCCGCAGGCGTTGCAGATTCTATCGGGGACTGCC
AGGGTCAAGAATCATGGCAAGTGA
Gene >Ophcf2|06947
ATGGACGCTCTGGAGACGCCGGCTGTCTTACCCTTCTGGAGCGCGCCGACGTCGTATCTCAAGTAGGCCGTCCGT
CAGCTTCCCGCCCGTCGTCTTGGCTGCTAATGGGCGCAGCTTCTGTGAAGAGGTGCTTTTCTGTCTGCTCCGCTG
CGGGACGGGACGCCTAATGAGTTGCCTGTTGCACAGGATTATGCGCTTACGCGGTATATTGCCGAGTTTATCAAT
ACCCTCAGCAGTCTCTCCTACGGTTCGTCGTCTTTTTCCTTGGCTCGAGAAGAAGCGTGGCTGATGATGTGATTT
TTTCGTCTTGTCAAGTCGCCTATGGAATCTATGGTCTGTCCAGCAACGGGAAGAGGCCTCAGTCGGCGTCTCGCG
TGGCCTCGTACTGCGGCCTGATGGGGGTGGGCATCTGCTCGGCCGGATACCACATGACGCTCAAGTATCACACTC
AGATGCGTTCGTCTTTACCGTTCTTCGAGTTCGTCTCTTCCTGACGTCTGATAGTGGACGAGCTGTCGATGCATC
TCCTCGCCACCCCGATCCTCTACCGCCTGCTCACCCTAGGAGCTGGGCCATACTATACAAAGGTGGTGGGAGTGA
CGCTGCTGGTGCTCTTCATCATCGTCATGACGACGCACATGCTCATGGACGAGTTTCTTCTCCATGCCACGACGT
TTGGCCTCGCCGTCTACCTGATTGCCTCGCGCATCTGGCAGATTATCCCGCAGAGGGTGCCGGATTCCCAGATTA
GGAAGAAGCTGCAGACTTTGACCAAGTTTGGCTGCGGTGAGTCTCTTTGCGAGTCTGGAAGAACGTGGTCTGACG
TGAGTTAGTGAATTTCCTCGGGGGGTATTTTCTTTGGCTGGTTGATGAGTGGGCTTGTGGGCTTCTCACCAAGAT
GAGGCATTCTGTTGGGATGCCTGTTGCCTTTTTTCTCGAGTTGCATGGTTGGTATGTCGTCTTCAGCTTATGAGT
TGTGTTATCAAGCTTGTTTCTGACGGGCTTAGGTGGCATATCCTGACTGCCATTGGCGGCTACATCGCCGTCGCC
ATCGTCGACGTCTTGACGTCTACGTCTGGGGAGGTGGTCGAAGATCCCATCCCTTCATTTGCCTGGCCGATTCCG
CAGGCGTTGCAGATTCTATCGGGGACTGCCAGGGTCAAGAATCATGGCAAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail