Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06945
Gene name
Locationscaffold_09:68043..69728
Strand+
Gene length (bp)1685
Transcript length (bp)1404
Coding sequence length (bp)1404
Protein length (aa) 468

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00557 Peptidase_M24 Metallopeptidase family M24 9.1E-55 186 444
PF05195 AMP_N Aminopeptidase P, N-terminal domain 8.5E-25 17 134

GO

GO Term Description Terminal node
GO:0070006 metalloaminopeptidase activity Yes
GO:0030145 manganese ion binding Yes
GO:0043169 cation binding No
GO:0004177 aminopeptidase activity No
GO:0046914 transition metal ion binding No
GO:0008237 metallopeptidase activity No
GO:0008233 peptidase activity No
GO:0003824 catalytic activity No
GO:0043167 ion binding No
GO:0016787 hydrolase activity No
GO:0008235 metalloexopeptidase activity No
GO:0008238 exopeptidase activity No
GO:0003674 molecular_function No
GO:0046872 metal ion binding No
GO:0140096 catalytic activity, acting on a protein No
GO:0005488 binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.6686 0.7738 0.0566 0.0366 0.4261 0.0569 0.1061 0.0108 0.0482 0.0078

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup235
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4874
Ophiocordyceps australis 1348a (Ghana) OphauG2|5858
Ophiocordyceps australis map64 (Brazil) OphauB2|258
Ophiocordyceps australis map64 (Brazil) OphauB2|746
Ophiocordyceps camponoti-floridani Ophcf2|06013
Ophiocordyceps camponoti-floridani Ophcf2|06945 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1590
Ophiocordyceps camponoti-rufipedis Ophun1|6825
Ophiocordyceps kimflemingae Ophio5|1016
Ophiocordyceps kimflemingae Ophio5|6975
Ophiocordyceps subramaniannii Hirsu2|4741
Ophiocordyceps subramaniannii Hirsu2|6360

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06945
MADFETILKAKYPAKAHAQRVVKLLREATPDANGVLYLEGRATRMQEDNDSPEPFRQRRHFYYLTGCNLADCRFA
YDMAADHSVLFIPPIDPDDVLWSGLPVSADEALARYDVDEVRYTTDVNATLARLAGRQKSDGKGMTTTVFAVAGH
VSDAVTFLEFDATDLTAVKAAVDRARVVKDEHEVAMMRKANHISGLAHAAVVRRARHAGLERELEAAFLERCVSL
GAPVMAYHPILAAGRAAATLHYVDNDARLGGKLNLLIDAGAEWNNYASDITRTFPLSGSFSKESRAIYDIVLKMQ
TECIGLAKAGALWDDIHLHAHEIAIDGLLSLGLLKGDKCEILEARTSAAFFPHGLGHYLGMDTHDVGGNPNREDK
DVLFRYLRLRGRIPAGSVVTVEPGIYFCEFILKPYLDDPVHGKYIDEAVLDKYWDVGGVRIEDNVLVTETGCENL
TTAVKEPAEIEALVAKG*
Coding >Ophcf2|06945
ATGGCCGACTTCGAGACGATCCTGAAGGCCAAGTATCCGGCCAAGGCGCACGCGCAGCGCGTCGTCAAGCTGCTG
CGCGAGGCTACACCGGATGCCAACGGCGTTCTCTATCTCGAGGGCCGAGCCACCCGCATGCAGGAGGACAACGAT
TCGCCCGAGCCTTTCCGACAGCGCCGGCATTTTTACTATCTCACCGGCTGCAACCTCGCCGATTGTCGGTTCGCC
TACGACATGGCGGCCGACCACTCGGTCCTCTTTATCCCGCCCATCGACCCAGACGATGTGCTCTGGTCCGGCCTG
CCTGTCAGCGCCGACGAGGCCCTCGCTCGATACGACGTCGACGAGGTGCGTTACACGACCGACGTCAACGCCACG
CTGGCTCGTCTAGCCGGCCGTCAAAAGTCCGATGGCAAGGGGATGACGACGACCGTCTTCGCTGTCGCCGGCCAC
GTTTCCGATGCCGTCACCTTTCTCGAGTTCGACGCGACCGATCTGACGGCCGTCAAGGCGGCCGTTGATCGCGCA
CGCGTCGTCAAGGATGAACACGAGGTAGCCATGATGCGCAAGGCGAATCACATCTCGGGCTTGGCCCATGCGGCC
GTCGTCCGCCGGGCGCGGCATGCTGGGCTGGAGCGCGAACTCGAGGCTGCCTTTCTCGAGCGCTGTGTCTCCCTC
GGTGCTCCTGTCATGGCTTATCATCCGATTCTGGCAGCGGGACGGGCAGCGGCCACGCTGCACTACGTCGATAAC
GATGCTCGTCTCGGCGGTAAGCTGAACTTGCTGATTGACGCTGGCGCAGAATGGAACAACTATGCGTCTGATATT
ACGAGGACGTTTCCCCTGTCCGGCTCCTTCAGCAAGGAGTCGCGCGCCATCTACGACATCGTGCTCAAAATGCAG
ACCGAGTGCATCGGCCTCGCCAAGGCCGGCGCGCTCTGGGACGACATCCATCTTCACGCTCATGAGATTGCCATC
GACGGGCTGCTATCGCTCGGCCTGCTCAAGGGTGACAAGTGCGAGATTCTCGAGGCCCGCACCAGCGCTGCCTTC
TTCCCGCACGGGCTGGGTCACTATCTCGGCATGGACACGCACGACGTCGGCGGCAATCCCAATCGCGAGGACAAG
GACGTGCTCTTCCGTTACCTGCGGCTTCGTGGACGGATTCCAGCCGGTAGCGTCGTCACTGTTGAGCCCGGGATT
TACTTTTGCGAGTTTATCCTGAAGCCGTACCTTGACGACCCTGTCCATGGGAAATACATCGACGAAGCCGTACTC
GACAAGTACTGGGATGTCGGTGGTGTGCGCATCGAGGACAACGTACTCGTCACCGAGACGGGCTGCGAGAATCTG
ACGACGGCGGTAAAAGAGCCGGCGGAGATTGAGGCACTCGTTGCCAAGGGCTGA
Transcript >Ophcf2|06945
ATGGCCGACTTCGAGACGATCCTGAAGGCCAAGTATCCGGCCAAGGCGCACGCGCAGCGCGTCGTCAAGCTGCTG
CGCGAGGCTACACCGGATGCCAACGGCGTTCTCTATCTCGAGGGCCGAGCCACCCGCATGCAGGAGGACAACGAT
TCGCCCGAGCCTTTCCGACAGCGCCGGCATTTTTACTATCTCACCGGCTGCAACCTCGCCGATTGTCGGTTCGCC
TACGACATGGCGGCCGACCACTCGGTCCTCTTTATCCCGCCCATCGACCCAGACGATGTGCTCTGGTCCGGCCTG
CCTGTCAGCGCCGACGAGGCCCTCGCTCGATACGACGTCGACGAGGTGCGTTACACGACCGACGTCAACGCCACG
CTGGCTCGTCTAGCCGGCCGTCAAAAGTCCGATGGCAAGGGGATGACGACGACCGTCTTCGCTGTCGCCGGCCAC
GTTTCCGATGCCGTCACCTTTCTCGAGTTCGACGCGACCGATCTGACGGCCGTCAAGGCGGCCGTTGATCGCGCA
CGCGTCGTCAAGGATGAACACGAGGTAGCCATGATGCGCAAGGCGAATCACATCTCGGGCTTGGCCCATGCGGCC
GTCGTCCGCCGGGCGCGGCATGCTGGGCTGGAGCGCGAACTCGAGGCTGCCTTTCTCGAGCGCTGTGTCTCCCTC
GGTGCTCCTGTCATGGCTTATCATCCGATTCTGGCAGCGGGACGGGCAGCGGCCACGCTGCACTACGTCGATAAC
GATGCTCGTCTCGGCGGTAAGCTGAACTTGCTGATTGACGCTGGCGCAGAATGGAACAACTATGCGTCTGATATT
ACGAGGACGTTTCCCCTGTCCGGCTCCTTCAGCAAGGAGTCGCGCGCCATCTACGACATCGTGCTCAAAATGCAG
ACCGAGTGCATCGGCCTCGCCAAGGCCGGCGCGCTCTGGGACGACATCCATCTTCACGCTCATGAGATTGCCATC
GACGGGCTGCTATCGCTCGGCCTGCTCAAGGGTGACAAGTGCGAGATTCTCGAGGCCCGCACCAGCGCTGCCTTC
TTCCCGCACGGGCTGGGTCACTATCTCGGCATGGACACGCACGACGTCGGCGGCAATCCCAATCGCGAGGACAAG
GACGTGCTCTTCCGTTACCTGCGGCTTCGTGGACGGATTCCAGCCGGTAGCGTCGTCACTGTTGAGCCCGGGATT
TACTTTTGCGAGTTTATCCTGAAGCCGTACCTTGACGACCCTGTCCATGGGAAATACATCGACGAAGCCGTACTC
GACAAGTACTGGGATGTCGGTGGTGTGCGCATCGAGGACAACGTACTCGTCACCGAGACGGGCTGCGAGAATCTG
ACGACGGCGGTAAAAGAGCCGGCGGAGATTGAGGCACTCGTTGCCAAGGGCTGA
Gene >Ophcf2|06945
ATGGCCGACTTCGAGACGATCCTGAAGGCCAAGTATCCGGCCAAGGCGCACGCGCAGCGCGTCGTCAAGCTGCTG
CGCGAGGCTACACCGGATGCCAACGGCGTTCTCTATCTCGAGGGCCGAGCCACCCGCATGCAGGAGGACAACGAT
TCGCCCGAGCCTTTCCGGTAAGCCGGCCTTGATCTCCTATCCGTTTGCCTTCGGTCTAAGATGGTAGCTATAATT
GGGGATAACTGACGGTGACCATGGAGATAGACAGCGCCGGCATTTTTACTATCTCACCGGCTGCAACCTCGCCGA
TTGTCGGTTCGCCTACGACATGGCGGCCGACCACTCGGTCCTCTTTATCCCGCCCATCGACCCAGACGATGTGCT
CTGGTCCGGCCTGCCTGTCAGCGCCGACGAGGCCCTCGCTCGATACGACGTCGACGAGGTGCGTTACACGACCGA
CGTCAACGCCACGCTGGCTCGTCTAGCCGGCCGTCAAAAGTCCGATGGCAAGGGGATGACGACGACCGTCTTCGC
TGTCGCCGGCCACGTTTCCGATGCCGTCACCTTTCTCGAGTTCGACGCGACCGATCTGACGGCCGTCAAGGCGGC
CGTTGATCGCGCACGCGTCGTCAAGGATGAACACGAGGTAGCCATGATGCGCAAGGCGAATCACATCTCGGGCTT
GGCCCATGCGGCCGTCGTCCGCCGGGCGCGGCATGCTGGGCTGGAGCGCGAACTCGAGGCTGCCTTTCTCGAGCG
CTGTGTCTCCCTCGGTGCTCCTGTCATGGCTTATCATCCGATTCTGGCAGCGGGACGGGCAGCGGCCACGCTGCA
CTACGTCGATAACGATGCTCGTCTCGGCGGTAAGCTGAACTTGCTGATTGACGCTGGCGCAGAATGGAACAACTA
TGCGTCTGATATTGTCAGATTCCTCTCCTCGACATGGCCCGATCTCACTGGCTGACCAGGACACAGACGAGGACG
TTTCCCCTGTCCGGCTCCTTCAGCAAGGAGTCGCGCGCCATCTACGACATCGTGCTCAAAATGCAGACCGAGTGC
ATCGGCCTCGCCAAGGCCGGCGCGCTCTGGGACGACATCCATCTTCACGCTCATGAGATTGCCATCGACGGGCTG
CTATCGCTCGGCCTGCTCAAGGGTGACAAGTGCGAGATTCTCGAGGCCCGCACCAGCGCTGCCTTCTTCCCGCAC
GGGCTGGGTCACTATCTCGGCATGGACACGCACGACGTCGGCGGCAATCCCAATCGCGAGGACAAGGACGTGCTC
TTCCGTTACCTGCGGCTTCGTGGACGGATTCCAGCCGGTAGCGTCGTCACTGTTGAGCCCGGGGTGCGTTCGGCC
CGTTTGCGACGTGGCTTGTCGTTCTGTGCTGACGGTTCTTTCTTTCAGATTTACTTTTGCGAGTTTATCCTGAAG
CCGTACCTTGACGACCCTGTCCATGGGAAATACATCGACGAAGCCGTACTCGACAAGTACTGGGATGTCGGTGGT
GTGCGGTGAGTGGGCTCTCAACTTCCCTCGCCCCCTTCCTTGCCCCTTTTGAAATCGCTGACTCTCTAACTCTAT
GTGCGTGTAGCATCGAGGACAACGTACTCGTCACCGAGACGGGCTGCGAGAATCTGACGACGGCGGTAAAAGAGC
CGGCGGAGATTGAGGCACTCGTTGCCAAGGGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail