Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06943
Gene name
Locationscaffold_09:62751..63716
Strand-
Gene length (bp)965
Transcript length (bp)720
Coding sequence length (bp)720
Protein length (aa) 240

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05670 NFACT-R_1 NFACT protein RNA binding domain 1.5E-25 63 138

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.4285 0.7245 0.0158 0.1202 0.1658 0.0041 0.0924 0.036 0.0504 0.0007

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4371
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2922
Ophiocordyceps australis map64 (Brazil) OphauB2|250
Ophiocordyceps camponoti-floridani Ophcf2|06943 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6443
Ophiocordyceps kimflemingae Ophio5|4281
Ophiocordyceps subramaniannii Hirsu2|9030

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06943
MVYYFTSNVVEPPATIYVGKDKFENEDLIKFGWEQDVWCVPGSLSLASYHGHDADHETVSALLRFHVDKLSSAHV
YLRLRDGQTWDAIPQDLVVDLAQLTKANSIEGNKKDNMTVIYTPWSNLHKNNAMDVGQVSFKDQRIVKRVLVPQR
ENAIVNRLNKTKVEKKPDLQRERDDRLKELRRIEQEALTQRRKEEAKQAQEWKEKKWQKDHAYDDMFTDESMASS
SNQDRGADWEDDFM*
Coding >Ophcf2|06943
ATGGTCTATTACTTCACCTCCAACGTGGTCGAGCCGCCGGCCACCATCTACGTCGGCAAAGACAAGTTTGAGAAT
GAGGATTTGATCAAGTTTGGCTGGGAGCAGGACGTTTGGTGCGTTCCCGGGTCCCTGTCCTTGGCCTCCTATCAT
GGACATGACGCTGACCACGAGACTGTTTCCGCCCTGCTCAGGTTCCACGTCGACAAGCTGTCCAGCGCCCACGTC
TACCTGCGCCTGCGAGATGGTCAAACCTGGGATGCCATCCCCCAGGACCTCGTCGTCGACCTCGCCCAGCTGACA
AAGGCCAACTCCATCGAAGGTAACAAAAAGGATAACATGACCGTCATCTACACGCCCTGGTCCAACCTCCACAAG
AACAATGCCATGGACGTCGGCCAGGTCAGCTTCAAGGACCAAAGAATAGTCAAGCGAGTGCTGGTCCCCCAACGC
GAAAACGCAATCGTCAATCGCCTCAACAAGACAAAGGTCGAGAAGAAGCCTGACCTGCAACGTGAGCGAGACGAT
CGCCTCAAGGAGCTACGGAGGATAGAACAGGAGGCATTGACCCAACGCAGAAAAGAAGAAGCCAAGCAGGCTCAG
GAATGGAAGGAGAAGAAATGGCAAAAGGACCACGCCTATGACGACATGTTCACCGACGAGAGCATGGCCTCGTCC
AGTAACCAGGACAGGGGCGCCGATTGGGAAGACGACTTCATGTAG
Transcript >Ophcf2|06943
ATGGTCTATTACTTCACCTCCAACGTGGTCGAGCCGCCGGCCACCATCTACGTCGGCAAAGACAAGTTTGAGAAT
GAGGATTTGATCAAGTTTGGCTGGGAGCAGGACGTTTGGTGCGTTCCCGGGTCCCTGTCCTTGGCCTCCTATCAT
GGACATGACGCTGACCACGAGACTGTTTCCGCCCTGCTCAGGTTCCACGTCGACAAGCTGTCCAGCGCCCACGTC
TACCTGCGCCTGCGAGATGGTCAAACCTGGGATGCCATCCCCCAGGACCTCGTCGTCGACCTCGCCCAGCTGACA
AAGGCCAACTCCATCGAAGGTAACAAAAAGGATAACATGACCGTCATCTACACGCCCTGGTCCAACCTCCACAAG
AACAATGCCATGGACGTCGGCCAGGTCAGCTTCAAGGACCAAAGAATAGTCAAGCGAGTGCTGGTCCCCCAACGC
GAAAACGCAATCGTCAATCGCCTCAACAAGACAAAGGTCGAGAAGAAGCCTGACCTGCAACGTGAGCGAGACGAT
CGCCTCAAGGAGCTACGGAGGATAGAACAGGAGGCATTGACCCAACGCAGAAAAGAAGAAGCCAAGCAGGCTCAG
GAATGGAAGGAGAAGAAATGGCAAAAGGACCACGCCTATGACGACATGTTCACCGACGAGAGCATGGCCTCGTCC
AGTAACCAGGACAGGGGCGCCGATTGGGAAGACGACTTCATGTAG
Gene >Ophcf2|06943
ATGGTCTATTACTTCACCTCCAACGTGGTCGAGCCGCCGGCCACCATCTACGTCGGCAAAGACAAGTTTGAGAGT
ATCTTTGCTGTCTCTGAGCTAGGCAGACGAGCGCGCCCCTAACCCGGACGGTCAGATGAGGATTTGATCAAGTTT
GGCTGGGAGCAGGACGTTTGGTGCGTTCCCGGGTCCCTGTCCTTGGCCTCCTATCATGGACATGACGCTGACCAC
GAGACTGTTTCCGCCCTGCTCAGGGTAGGGTCCGTTGATGCCCGTTTTCCCGAACCGCTCGCTCACGCTCGAGTC
TCGTCATAGTTCCACGTCGACAAGCTGTCCAGCGCCCACGTCTACCTGCGCCTGCGAGATGGTCAAACCTGGGAT
GCCATCCCCCAGGACCTCGTCGTCGACCTCGCCCAGCTGACAAAGGCCAACTCCATCGAAGGCACGCCGATCCCT
GGACGCCGAGTCCAAAAAAACTCCTCTCCTCCCTCAACGCTGACATAACCCTCAAGGTAACAAAAAGGATAACAT
GACCGTCATCTACACGCCCTGGTCCAACCTCCACAAGAACAATGCCATGGACGTCGGCCAGGTCAGCTTCAAGGA
CCAAAGAATAGTCAAGCGAGTGCTGGTCCCCCAACGCGAAAACGCAATCGTCAATCGCCTCAACAAGACAAAGGT
CGAGAAGAAGCCTGACCTGCAACGTGAGCGAGACGATCGCCTCAAGGAGCTACGGAGGATAGAACAGGAGGCATT
GACCCAACGCGTCTGTCCCAACCATATCATCTTCTACCCATTCGAACCGAGACTAAAGATTAATCTAGAGAAAAG
AAGAAGCCAAGCAGGCTCAGGAATGGAAGGAGAAGAAATGGCAAAAGGACCACGCCTATGACGACATGTTCACCG
ACGAGAGCATGGCCTCGTCCAGTAACCAGGACAGGGGCGCCGATTGGGAAGACGACTTCATGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail