Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06941
Gene name
Locationscaffold_09:54847..57578
Strand+
Gene length (bp)2731
Transcript length (bp)2664
Coding sequence length (bp)2664
Protein length (aa) 888

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00082 Peptidase_S8 Subtilase family 2.4E-44 149 573
PF06280 fn3_5 Fn3-like domain 2.6E-14 616 730
PF02225 PA PA domain 1.2E-06 379 439

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0006508 proteolysis Yes
GO:0004252 serine-type endopeptidase activity Yes
GO:0008236 serine-type peptidase activity Yes
GO:0005618 cell wall Yes
GO:0110165 cellular anatomical entity No
GO:0071704 organic substance metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0008152 metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0017171 serine hydrolase activity No
GO:0043170 macromolecule metabolic process No
GO:0003824 catalytic activity No
GO:0019538 protein metabolic process No
GO:0044238 primary metabolic process No
GO:0005575 cellular_component No
GO:0006807 nitrogen compound metabolic process No
GO:0016787 hydrolase activity No
GO:0003674 molecular_function No
GO:0004175 endopeptidase activity No
GO:0008233 peptidase activity No
GO:0030312 external encapsulating structure No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

Domain # Start End Length
1 5 27 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06941
MVRAYALLTALAATLSAASVVPGAYIIELEEGIDTSPVYREIDKQGTKRMQLEFKLFRGVSVQLSDLQGAEQRAA
LFAAMPAVRNVWPVRLYRMPSPKVEWIGSGGPLQAEPRRLAGRSEEEAHGEARDDFTPHVMTQVDKLRAQGITGK
GTRIAVVDTGIDYLHPALGGCFGPGCLVSFGYDFVGDAFNGTNTPIPDSDPMDCGGHGTHVAGIVAAQGGSNNTF
GFTGAAPDVTLGAYKVFGCKGEASNEVLIAAFNQAYDDGADIITSSIGGPSGWPEEPWAAAVSRIVAQGVPCTIS
AGNEGEMGLLYASGAADGKGVLSVASVDNKVTPVLLYRVKYRVDDGPEQPFGYAPGDPEGWENVTLPLRATSLMT
NITDDGCGPQHHDNGTMPLKDLAGYVVLIKRGTCTFEEKARNAVARGAQYILFYNNVEGAIATDVTMVAGVKAAG
MVEFPQAETWIKELREGRRVVVEMVGRNHADLSLQVVPNKATGGAISEFSSWGPTWEVGVKPQFSAPGGSILSTY
PRAKGSYAVLSGTSMSCPLTAAVIALIGQVRGSLDPKMLETVLSATARPGPFNNGKTFSDVLAPVPQQGGGLIQA
FDAAYVQTMLEPSSLSFNDTDHFAADGVNFIVTNVGREPVEYRFSHIPAITMYTLAPGSYRPAKFPNDIVASAYA
NITFSCETVKLGPGEKAEVTVRAVPPVGLDASRLAVWSGFVMVNGSNGTSLSLPYQGLTGSLHKSRVLGPYDVSI
VRSTDKSRTPQPSNTTFVLPAPGTAWQGMDLPAIAVNPALGSPLQRVDLVPLTYPLPANATEYKGIMTIGQPAGF
PSYWNTRGFNPTPWDGLLDSGTYAPPGEYRLVVRALHIFGDARNDSDWDVAFSPMIRIKYSA*
Coding >Ophcf2|06941
ATGGTTCGTGCGTACGCTCTCCTCACGGCGCTGGCGGCGACGCTGTCGGCCGCGTCGGTCGTTCCCGGGGCGTAC
ATCATCGAGCTGGAAGAGGGCATCGACACCTCGCCTGTCTACCGTGAGATCGACAAACAGGGCACCAAGCGGATG
CAGCTCGAATTCAAGCTCTTTCGTGGCGTGTCAGTGCAGCTGTCGGATCTGCAAGGCGCCGAGCAAAGGGCGGCC
CTTTTCGCGGCCATGCCGGCCGTCCGCAACGTCTGGCCCGTGCGGCTCTACCGCATGCCGAGTCCCAAGGTGGAG
TGGATCGGGTCCGGAGGGCCGTTACAGGCCGAGCCGCGCCGGTTGGCGGGACGGTCAGAAGAGGAGGCTCACGGC
GAGGCCCGGGATGACTTCACGCCCCATGTCATGACGCAGGTGGACAAGCTTCGGGCACAGGGCATAACGGGGAAA
GGGACGCGTATTGCCGTCGTCGACACTGGCATCGATTACCTTCATCCTGCACTGGGCGGATGCTTCGGTCCCGGC
TGTCTCGTCTCTTTCGGCTACGACTTTGTTGGCGATGCCTTCAACGGCACCAACACGCCCATTCCGGACTCGGAC
CCCATGGACTGCGGCGGGCACGGAACCCACGTAGCAGGCATCGTGGCGGCTCAGGGCGGCAGCAACAACACCTTT
GGCTTCACGGGAGCGGCACCCGACGTGACGCTCGGCGCCTACAAGGTCTTTGGCTGCAAGGGCGAGGCATCCAAC
GAGGTTCTCATCGCCGCCTTCAACCAGGCGTATGACGACGGCGCCGACATCATCACGTCGTCCATTGGCGGCCCT
AGTGGTTGGCCGGAAGAGCCATGGGCGGCGGCCGTGTCGCGAATCGTTGCCCAGGGCGTTCCTTGCACGATATCG
GCGGGCAATGAAGGCGAAATGGGACTGCTCTACGCCAGCGGCGCCGCCGACGGTAAGGGAGTCTTGTCAGTGGCA
TCCGTCGACAACAAGGTGACGCCGGTGCTGCTGTATCGCGTCAAGTACAGGGTCGACGACGGACCCGAGCAGCCG
TTCGGGTACGCTCCCGGCGATCCTGAGGGCTGGGAAAACGTGACGCTGCCGCTGCGGGCGACGAGTCTGATGACC
AACATCACCGACGACGGCTGCGGTCCTCAGCATCATGATAACGGCACGATGCCGCTTAAGGATCTGGCCGGCTAT
GTCGTCCTCATTAAGCGCGGGACGTGCACTTTTGAGGAAAAGGCCAGGAACGCAGTGGCGCGCGGCGCCCAGTAC
ATCCTCTTCTATAACAACGTCGAGGGTGCCATCGCTACCGATGTCACCATGGTGGCGGGCGTGAAGGCCGCTGGC
ATGGTCGAGTTCCCCCAGGCAGAGACTTGGATCAAGGAACTCCGCGAGGGCCGCCGCGTCGTTGTCGAAATGGTC
GGGCGCAACCACGCGGACCTGTCTCTCCAGGTCGTTCCTAACAAGGCGACTGGAGGTGCCATCAGCGAGTTTAGC
AGCTGGGGACCGACGTGGGAGGTGGGCGTCAAGCCGCAGTTCAGCGCTCCGGGGGGCAGCATCTTGTCGACGTAT
CCGCGGGCTAAGGGCTCCTACGCCGTGCTGTCGGGGACATCAATGTCGTGTCCGCTGACGGCGGCCGTCATTGCT
CTCATCGGCCAGGTTCGGGGCTCCTTGGACCCCAAGATGCTCGAGACGGTCCTGTCAGCCACGGCCCGGCCGGGA
CCCTTCAACAACGGCAAGACGTTTTCGGATGTGCTCGCGCCTGTGCCGCAGCAGGGCGGCGGTCTCATCCAGGCC
TTTGATGCCGCCTATGTGCAGACGATGCTGGAGCCGTCGAGTCTGTCGTTCAACGACACGGATCACTTCGCGGCC
GACGGCGTCAACTTTATCGTCACCAACGTCGGCCGTGAGCCCGTCGAGTATCGCTTCTCGCACATCCCGGCCATC
ACCATGTACACGCTGGCCCCGGGGTCTTACCGTCCGGCCAAGTTCCCCAACGACATCGTGGCATCGGCCTACGCA
AACATCACCTTTAGCTGCGAGACGGTCAAGCTCGGACCGGGGGAAAAGGCCGAGGTGACGGTCCGGGCCGTGCCG
CCGGTGGGCCTCGACGCCAGCCGGCTGGCCGTGTGGTCCGGGTTCGTCATGGTCAACGGCTCGAACGGGACGTCT
CTCTCGCTACCGTACCAGGGTCTGACGGGCTCGCTGCACAAGTCGCGTGTTCTCGGCCCTTACGACGTCTCCATC
GTCCGGTCGACTGACAAGAGTAGGACGCCGCAGCCGTCCAACACGACCTTTGTGCTCCCCGCGCCGGGAACGGCC
TGGCAGGGCATGGACTTGCCGGCCATCGCCGTCAATCCGGCGCTCGGATCCCCGCTGCAGCGAGTCGACTTGGTG
CCGCTGACATACCCGCTGCCGGCCAACGCAACCGAGTACAAGGGCATCATGACCATCGGTCAGCCGGCCGGCTTC
CCGTCGTACTGGAACACGCGCGGCTTTAACCCAACGCCGTGGGACGGATTGCTCGACTCGGGAACTTACGCACCA
CCTGGCGAATATAGGTTGGTCGTCCGGGCGCTTCACATCTTTGGCGACGCGCGGAATGATTCGGACTGGGACGTT
GCCTTTTCGCCCATGATAAGGATTAAGTACAGTGCCTGA
Transcript >Ophcf2|06941
ATGGTTCGTGCGTACGCTCTCCTCACGGCGCTGGCGGCGACGCTGTCGGCCGCGTCGGTCGTTCCCGGGGCGTAC
ATCATCGAGCTGGAAGAGGGCATCGACACCTCGCCTGTCTACCGTGAGATCGACAAACAGGGCACCAAGCGGATG
CAGCTCGAATTCAAGCTCTTTCGTGGCGTGTCAGTGCAGCTGTCGGATCTGCAAGGCGCCGAGCAAAGGGCGGCC
CTTTTCGCGGCCATGCCGGCCGTCCGCAACGTCTGGCCCGTGCGGCTCTACCGCATGCCGAGTCCCAAGGTGGAG
TGGATCGGGTCCGGAGGGCCGTTACAGGCCGAGCCGCGCCGGTTGGCGGGACGGTCAGAAGAGGAGGCTCACGGC
GAGGCCCGGGATGACTTCACGCCCCATGTCATGACGCAGGTGGACAAGCTTCGGGCACAGGGCATAACGGGGAAA
GGGACGCGTATTGCCGTCGTCGACACTGGCATCGATTACCTTCATCCTGCACTGGGCGGATGCTTCGGTCCCGGC
TGTCTCGTCTCTTTCGGCTACGACTTTGTTGGCGATGCCTTCAACGGCACCAACACGCCCATTCCGGACTCGGAC
CCCATGGACTGCGGCGGGCACGGAACCCACGTAGCAGGCATCGTGGCGGCTCAGGGCGGCAGCAACAACACCTTT
GGCTTCACGGGAGCGGCACCCGACGTGACGCTCGGCGCCTACAAGGTCTTTGGCTGCAAGGGCGAGGCATCCAAC
GAGGTTCTCATCGCCGCCTTCAACCAGGCGTATGACGACGGCGCCGACATCATCACGTCGTCCATTGGCGGCCCT
AGTGGTTGGCCGGAAGAGCCATGGGCGGCGGCCGTGTCGCGAATCGTTGCCCAGGGCGTTCCTTGCACGATATCG
GCGGGCAATGAAGGCGAAATGGGACTGCTCTACGCCAGCGGCGCCGCCGACGGTAAGGGAGTCTTGTCAGTGGCA
TCCGTCGACAACAAGGTGACGCCGGTGCTGCTGTATCGCGTCAAGTACAGGGTCGACGACGGACCCGAGCAGCCG
TTCGGGTACGCTCCCGGCGATCCTGAGGGCTGGGAAAACGTGACGCTGCCGCTGCGGGCGACGAGTCTGATGACC
AACATCACCGACGACGGCTGCGGTCCTCAGCATCATGATAACGGCACGATGCCGCTTAAGGATCTGGCCGGCTAT
GTCGTCCTCATTAAGCGCGGGACGTGCACTTTTGAGGAAAAGGCCAGGAACGCAGTGGCGCGCGGCGCCCAGTAC
ATCCTCTTCTATAACAACGTCGAGGGTGCCATCGCTACCGATGTCACCATGGTGGCGGGCGTGAAGGCCGCTGGC
ATGGTCGAGTTCCCCCAGGCAGAGACTTGGATCAAGGAACTCCGCGAGGGCCGCCGCGTCGTTGTCGAAATGGTC
GGGCGCAACCACGCGGACCTGTCTCTCCAGGTCGTTCCTAACAAGGCGACTGGAGGTGCCATCAGCGAGTTTAGC
AGCTGGGGACCGACGTGGGAGGTGGGCGTCAAGCCGCAGTTCAGCGCTCCGGGGGGCAGCATCTTGTCGACGTAT
CCGCGGGCTAAGGGCTCCTACGCCGTGCTGTCGGGGACATCAATGTCGTGTCCGCTGACGGCGGCCGTCATTGCT
CTCATCGGCCAGGTTCGGGGCTCCTTGGACCCCAAGATGCTCGAGACGGTCCTGTCAGCCACGGCCCGGCCGGGA
CCCTTCAACAACGGCAAGACGTTTTCGGATGTGCTCGCGCCTGTGCCGCAGCAGGGCGGCGGTCTCATCCAGGCC
TTTGATGCCGCCTATGTGCAGACGATGCTGGAGCCGTCGAGTCTGTCGTTCAACGACACGGATCACTTCGCGGCC
GACGGCGTCAACTTTATCGTCACCAACGTCGGCCGTGAGCCCGTCGAGTATCGCTTCTCGCACATCCCGGCCATC
ACCATGTACACGCTGGCCCCGGGGTCTTACCGTCCGGCCAAGTTCCCCAACGACATCGTGGCATCGGCCTACGCA
AACATCACCTTTAGCTGCGAGACGGTCAAGCTCGGACCGGGGGAAAAGGCCGAGGTGACGGTCCGGGCCGTGCCG
CCGGTGGGCCTCGACGCCAGCCGGCTGGCCGTGTGGTCCGGGTTCGTCATGGTCAACGGCTCGAACGGGACGTCT
CTCTCGCTACCGTACCAGGGTCTGACGGGCTCGCTGCACAAGTCGCGTGTTCTCGGCCCTTACGACGTCTCCATC
GTCCGGTCGACTGACAAGAGTAGGACGCCGCAGCCGTCCAACACGACCTTTGTGCTCCCCGCGCCGGGAACGGCC
TGGCAGGGCATGGACTTGCCGGCCATCGCCGTCAATCCGGCGCTCGGATCCCCGCTGCAGCGAGTCGACTTGGTG
CCGCTGACATACCCGCTGCCGGCCAACGCAACCGAGTACAAGGGCATCATGACCATCGGTCAGCCGGCCGGCTTC
CCGTCGTACTGGAACACGCGCGGCTTTAACCCAACGCCGTGGGACGGATTGCTCGACTCGGGAACTTACGCACCA
CCTGGCGAATATAGGTTGGTCGTCCGGGCGCTTCACATCTTTGGCGACGCGCGGAATGATTCGGACTGGGACGTT
GCCTTTTCGCCCATGATAAGGATTAAGTACAGTGCCTGA
Gene >Ophcf2|06941
ATGGTTCGTGCGTACGCTCTCCTCACGGCGCTGGCGGCGACGCTGTCGGCCGCGTCGGTCGTTCCCGGGGCGTAC
ATCATCGAGCTGGAAGAGGGCATCGACACCTCGCCTGTCTACCGTGAGATCGACAAACAGGGCACCAAGCGGATG
CAGCTCGAATTCAAGCTCTTTCGTGGCGTGTCAGTGCAGCTGTCGGATCTGCAAGGCGCCGAGCAAAGGGCGGCC
CTTTTCGCGGCCATGCCGGCCGTCCGCAACGTCTGGCCCGTGCGGCTCTACCGCATGCCGAGTCCCAAGGTGGAG
TGGATCGGGTCCGGAGGGCCGTTACAGGCCGAGCCGCGCCGGTTGGCGGGACGGTCAGAAGAGGAGGCTCACGGC
GAGGCCCGGGATGACTTCACGCCCCATGTCATGACGCAGGTGGACAAGCTTCGGGCACAGGGCATAACGGGGAAA
GGGACGCGTATTGCCGTCGTCGACACTGGCGTCAGTCCAAGCCTTACCCCCCCCCCCTCCCCTTTCCCCTGAGAT
ACTCAGCTGACGGCTTCATCAGATCGATTACCTTCATCCTGCACTGGGCGGATGCTTCGGTCCCGGCTGTCTCGT
CTCTTTCGGCTACGACTTTGTTGGCGATGCCTTCAACGGCACCAACACGCCCATTCCGGACTCGGACCCCATGGA
CTGCGGCGGGCACGGAACCCACGTAGCAGGCATCGTGGCGGCTCAGGGCGGCAGCAACAACACCTTTGGCTTCAC
GGGAGCGGCACCCGACGTGACGCTCGGCGCCTACAAGGTCTTTGGCTGCAAGGGCGAGGCATCCAACGAGGTTCT
CATCGCCGCCTTCAACCAGGCGTATGACGACGGCGCCGACATCATCACGTCGTCCATTGGCGGCCCTAGTGGTTG
GCCGGAAGAGCCATGGGCGGCGGCCGTGTCGCGAATCGTTGCCCAGGGCGTTCCTTGCACGATATCGGCGGGCAA
TGAAGGCGAAATGGGACTGCTCTACGCCAGCGGCGCCGCCGACGGTAAGGGAGTCTTGTCAGTGGCATCCGTCGA
CAACAAGGTGACGCCGGTGCTGCTGTATCGCGTCAAGTACAGGGTCGACGACGGACCCGAGCAGCCGTTCGGGTA
CGCTCCCGGCGATCCTGAGGGCTGGGAAAACGTGACGCTGCCGCTGCGGGCGACGAGTCTGATGACCAACATCAC
CGACGACGGCTGCGGTCCTCAGCATCATGATAACGGCACGATGCCGCTTAAGGATCTGGCCGGCTATGTCGTCCT
CATTAAGCGCGGGACGTGCACTTTTGAGGAAAAGGCCAGGAACGCAGTGGCGCGCGGCGCCCAGTACATCCTCTT
CTATAACAACGTCGAGGGTGCCATCGCTACCGATGTCACCATGGTGGCGGGCGTGAAGGCCGCTGGCATGGTCGA
GTTCCCCCAGGCAGAGACTTGGATCAAGGAACTCCGCGAGGGCCGCCGCGTCGTTGTCGAAATGGTCGGGCGCAA
CCACGCGGACCTGTCTCTCCAGGTCGTTCCTAACAAGGCGACTGGAGGTGCCATCAGCGAGTTTAGCAGCTGGGG
ACCGACGTGGGAGGTGGGCGTCAAGCCGCAGTTCAGCGCTCCGGGGGGCAGCATCTTGTCGACGTATCCGCGGGC
TAAGGGCTCCTACGCCGTGCTGTCGGGGACATCAATGTCGTGTCCGCTGACGGCGGCCGTCATTGCTCTCATCGG
CCAGGTTCGGGGCTCCTTGGACCCCAAGATGCTCGAGACGGTCCTGTCAGCCACGGCCCGGCCGGGACCCTTCAA
CAACGGCAAGACGTTTTCGGATGTGCTCGCGCCTGTGCCGCAGCAGGGCGGCGGTCTCATCCAGGCCTTTGATGC
CGCCTATGTGCAGACGATGCTGGAGCCGTCGAGTCTGTCGTTCAACGACACGGATCACTTCGCGGCCGACGGCGT
CAACTTTATCGTCACCAACGTCGGCCGTGAGCCCGTCGAGTATCGCTTCTCGCACATCCCGGCCATCACCATGTA
CACGCTGGCCCCGGGGTCTTACCGTCCGGCCAAGTTCCCCAACGACATCGTGGCATCGGCCTACGCAAACATCAC
CTTTAGCTGCGAGACGGTCAAGCTCGGACCGGGGGAAAAGGCCGAGGTGACGGTCCGGGCCGTGCCGCCGGTGGG
CCTCGACGCCAGCCGGCTGGCCGTGTGGTCCGGGTTCGTCATGGTCAACGGCTCGAACGGGACGTCTCTCTCGCT
ACCGTACCAGGGTCTGACGGGCTCGCTGCACAAGTCGCGTGTTCTCGGCCCTTACGACGTCTCCATCGTCCGGTC
GACTGACAAGAGTAGGACGCCGCAGCCGTCCAACACGACCTTTGTGCTCCCCGCGCCGGGAACGGCCTGGCAGGG
CATGGACTTGCCGGCCATCGCCGTCAATCCGGCGCTCGGATCCCCGCTGCAGCGAGTCGACTTGGTGCCGCTGAC
ATACCCGCTGCCGGCCAACGCAACCGAGTACAAGGGCATCATGACCATCGGTCAGCCGGCCGGCTTCCCGTCGTA
CTGGAACACGCGCGGCTTTAACCCAACGCCGTGGGACGGATTGCTCGACTCGGGAACTTACGCACCACCTGGCGA
ATATAGGTTGGTCGTCCGGGCGCTTCACATCTTTGGCGACGCGCGGAATGATTCGGACTGGGACGTTGCCTTTTC
GCCCATGATAAGGATTAAGTACAGTGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail