Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06939
Gene name
Locationscaffold_09:44911..51970
Strand+
Gene length (bp)7059
Transcript length (bp)6864
Coding sequence length (bp)6864
Protein length (aa) 2288

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08326 ACC_central Acetyl-CoA carboxylase, central region 4.3E-277 771 1522
PF01039 Carboxyl_trans Carboxyl transferase domain 1.3E-183 1624 2176
PF02786 CPSase_L_D2 Carbamoyl-phosphate synthase L chain, ATP binding domain 7.5E-53 233 416
PF00289 Biotin_carb_N Biotin carboxylase, N-terminal domain 1.4E-27 63 184
PF02785 Biotin_carb_C Biotin carboxylase C-terminal domain 8.3E-20 460 567
PF00364 Biotin_lipoyl Biotin-requiring enzyme 7.9E-17 705 769

GO

GO Term Description Terminal node
GO:0003989 acetyl-CoA carboxylase activity Yes
GO:0006633 fatty acid biosynthetic process Yes
GO:0005524 ATP binding Yes
GO:0016421 CoA carboxylase activity No
GO:0006629 lipid metabolic process No
GO:0044238 primary metabolic process No
GO:0044281 small molecule metabolic process No
GO:0044283 small molecule biosynthetic process No
GO:0003824 catalytic activity No
GO:1901265 nucleoside phosphate binding No
GO:1901576 organic substance biosynthetic process No
GO:0009058 biosynthetic process No
GO:0005488 binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0016885 ligase activity, forming carbon-carbon bonds No
GO:0044255 cellular lipid metabolic process No
GO:0008152 metabolic process No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0019752 carboxylic acid metabolic process No
GO:0009987 cellular process No
GO:0043436 oxoacid metabolic process No
GO:0044237 cellular metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0036094 small molecule binding No
GO:0071704 organic substance metabolic process No
GO:0006631 fatty acid metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0097367 carbohydrate derivative binding No
GO:0030554 adenyl nucleotide binding No
GO:0008150 biological_process No
GO:0043167 ion binding No
GO:0006082 organic acid metabolic process No
GO:0046394 carboxylic acid biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0016874 ligase activity No
GO:0032787 monocarboxylic acid metabolic process No
GO:0000166 nucleotide binding No
GO:0072330 monocarboxylic acid biosynthetic process No
GO:0032555 purine ribonucleotide binding No
GO:0008610 lipid biosynthetic process No
GO:0017076 purine nucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0003674 molecular_function No
GO:0016053 organic acid biosynthetic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.627 0.314 0.1258 0.0579 0.3636 0.0365 0.1114 0.1822 0.089 0.1223

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2866
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7204
Ophiocordyceps australis map64 (Brazil) OphauB2|245
Ophiocordyceps camponoti-floridani Ophcf2|06939 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6439
Ophiocordyceps kimflemingae Ophio5|7967
Ophiocordyceps subramaniannii Hirsu2|4746

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06939
MVSATPVATNGTNGRTVPVSNGKASYAEKHAVADHFIGGNALANAPAGKVKDFVAQNDGHTVITNVLIANNGIAA
VKEIRSVRKWAYETFGDERAIHFTVMATPEDLQANADYIRMADHYVEVPGGTNNHNYANVELIVDIAERMNVHAV
WAGWGHASENPKLPESLAASPNKIVFIGPPGSAMRSLGDKISSTIVAQHALVPCIPWSGTGVNAVDIDAKGIVTV
PDNVYAKGCVTSWQEGLEKAKEIGFPVMIKASEGGGGKGIRKATNEDEFEALYKAAASEIPGSPIFIMKLAGNAR
HLEVQLLADQYGNNISLFGRDCSVQRRHQKIIEEAPVTIAKADTFKAMEDAAVRLGKLVGYVSAGTVEYLYSHAD
DKFYFLELNPRLQVEHPTTEMVSGVNLPAAQLQIAMGVPLHRVRDIRLLYGVDPKASSLIDFEFKQHGTAQSQRR
PTPTGHTTACRITSEDPGEGFKPSNGVMHELNFRSSSNVWGYFSVGTQGGIHSFSDSQFGHIFAYGENRQASRKH
MVIALKELSIRGDFRTTVEYLIKLLETEDFEENTISTGWLDELISKRLTAERPDPMLAVVCGATTKAHIASEACL
AEYRAGLEKGQVPSKEILKTVFTIDFIYEGFRYKFTATRASADSYHLFINGSKCSVGVRALSDGGLLILLDGHSH
NVYWKEEVGATRLSVDSKTCLLEQENDPTQLRSPSPGKLVKYTVENGAHVKAGQTFAEVEVMKMYMPLIAQEDGI
VQLIKQPGATLEAGDILGILALDDPSRVKQAQAFVDKLPAYGEPVVVGNKPAQRFSVLRDIITNILMGYDNSVIM
APALKELIEVLRNPELPYSEWNACFSALHARMPQKLDAQLVQVVERARARHAEFPARTLIKALHKFMEESVADAD
VDLLKVTLAPLLEILTQYADGQKVRELNFIDSLLGTYWDVEKLFVGQVQEDAVVLKLRDQNKDNINKVLQIVLSH
SRVSAKSSLMLAILDEYRPNRPNVGNIGKYLRDSLRRLTELSSRPTSKVSLKAREIMIQCSLPSLEERTAQLEHI
LRSSVVESRYGESGWDHREPNLDVIKEVVDSKYTVFDVLPLFFAHEDPWVALASLEVYVRRSYRAYVLQQIEYHN
DESDLPLFVSWDFQLRKLGQSEFGLPLMSAAPSTPGTPVTPANNSRPFMNRISSISDMSYLSSKWDEEPTRKGII
APCRYLDDAEDMIQKALETLAVHNKQKKLNNGTNILAELNGKRKPSSAMKQDVRKGDELSAVINIAVRDAETRDD
EEIMSRILPVVEQFKGDMLARGVRRLTFICGHSDGGYPGYYTFRGPEYNEDDSIRHSEPALAFQLELGRLAKFGI
KPVFTQNKNIHVYEAVGKAVDTDKRYFTRAVIRPGRLRDEIPTAEYLISEADRVINDIFDALEIIGNNSSDLNHI
FMNFTPVFQLDPQQVEKSLQGFLDRFGPRGWRLRVSQVEIRIICTDPTTSTPYPLRVVVTNTSGYIVDVDMYAER
KSEKGEWLFHSIGGTKEKGPLHLLSVSTPYATKNALQPKRYKAHLMGTQYVYDFPELFRQAIQNSWAKAVQNQPT
LASQRPKVGECITFTELVLDEQDNIDEVNREPGTNTCGMVGWIFRARTPEYPAGRRFVVIANDITYKIGSFGPKE
DNFFHKCTELARRLGIPRIYLSANSGARLGLAEELIPHFKVAWNDPEKPEAGFRYLYLDDKTRQGFKKDVITEEV
SEGGEKRHRIVTIVGQEDGLGVECLKGSGLIAGATSRAYEDIFTVTLVTCRSVGIGAYLVRLGQRAVQIEGQPII
LTGAPALNNLLGREVYTSNLQLGGTQIMYRNGVSHMTANDDFAGISRIVEWMSFVPEKRNGPVPISPSVDDWNRD
VTYCPPQKQPYDVRWMIAGKEDEDGGFLSGLFDRDSFVEALGGWARTVVVGRARLGGIPMGVIGVETRSVENITP
ADPANPDSMEQVSNEAGGVWYPNSAFKTAQAINDFNKGEQLPLMILANWRGFSGGQRDMYNEVLKYGSFIVDALV
KFEQPIFVYVPPFGELRGGSWVVVDPTINPTVMEMYADNEARGGVLEPEGMIGIKFRKEKQLETMARLDPTYAGL
KRRLEDKSLSAEEAAEVKSKMTIREKMLLPVYAQVAVQFADLHDRAGRMKAKGAIRDSLSWINARRFFYWRLRRR
LNEEYILKRMASKDANNNQVKAAEARARNMLLLESWSGITGWGHNDREVAEWYEKERKSIGEKVEALKAEKVSAE
VSEAVRSHKDAGWKGVREVLRVMPTEEREAMLKYLRG*
Coding >Ophcf2|06939
ATGGTGTCAGCGACGCCTGTCGCCACAAACGGCACCAATGGCCGCACTGTTCCCGTCTCCAACGGAAAGGCGTCC
TACGCGGAGAAGCACGCCGTTGCTGACCACTTCATCGGCGGCAACGCGCTGGCTAATGCCCCGGCCGGCAAGGTC
AAGGACTTTGTCGCCCAAAACGATGGCCACACCGTTATCACAAACGTACTCATAGCAAATAACGGCATCGCTGCC
GTCAAGGAGATCCGCTCCGTCCGGAAATGGGCGTACGAGACGTTTGGCGACGAGCGTGCCATCCATTTCACCGTC
ATGGCTACCCCCGAGGATCTTCAGGCCAACGCAGACTATATCCGCATGGCCGATCACTACGTCGAGGTCCCGGGC
GGCACCAACAACCACAACTACGCCAACGTGGAGCTAATAGTTGACATTGCCGAGCGGATGAACGTACACGCCGTC
TGGGCCGGCTGGGGCCACGCTTCTGAGAACCCCAAGCTGCCAGAGTCGCTGGCAGCCTCTCCAAATAAGATAGTC
TTCATCGGTCCCCCGGGATCCGCCATGAGGTCTCTGGGTGATAAAATCTCGTCCACCATCGTTGCCCAGCACGCC
CTCGTACCATGCATACCATGGTCTGGCACGGGCGTCAACGCCGTCGATATCGACGCAAAGGGCATCGTCACCGTC
CCCGATAACGTCTACGCCAAGGGCTGCGTCACTTCATGGCAGGAAGGTCTGGAAAAGGCAAAGGAGATTGGCTTT
CCCGTCATGATCAAGGCCTCAGAAGGCGGCGGCGGTAAGGGCATCCGCAAAGCTACCAACGAGGACGAGTTCGAG
GCCCTATACAAGGCGGCAGCCAGCGAGATCCCCGGCTCGCCCATTTTCATCATGAAGCTGGCCGGCAACGCGCGT
CATCTCGAAGTCCAGCTGCTGGCTGACCAATATGGCAACAACATCTCCCTGTTTGGTCGTGACTGCTCTGTTCAG
CGGCGTCATCAGAAGATTATCGAGGAGGCGCCCGTCACCATCGCAAAGGCCGACACCTTCAAGGCCATGGAGGAC
GCCGCCGTCCGGCTCGGCAAGCTGGTGGGCTACGTCTCGGCCGGCACCGTCGAATATCTATACTCGCACGCCGAC
GACAAATTCTACTTCCTCGAGCTCAACCCGCGTTTGCAGGTCGAGCATCCGACGACGGAAATGGTCAGCGGCGTC
AACCTGCCCGCCGCCCAGCTCCAGATCGCCATGGGCGTGCCGCTGCACCGCGTCCGCGACATCAGGCTGCTCTAC
GGCGTCGACCCCAAGGCCTCGAGTCTCATCGACTTTGAGTTCAAGCAGCACGGCACCGCTCAGTCTCAGCGCCGC
CCGACGCCCACTGGCCATACCACCGCCTGCCGCATCACCTCTGAGGACCCGGGTGAGGGCTTCAAGCCCTCCAAC
GGCGTCATGCACGAGCTCAACTTCAGGAGCAGCTCCAATGTCTGGGGCTACTTCTCCGTCGGCACCCAGGGTGGT
ATCCACAGCTTCTCCGACAGCCAGTTCGGCCATATTTTCGCCTACGGCGAGAACCGCCAGGCCTCGCGCAAGCAC
ATGGTCATCGCCCTGAAGGAGCTCAGCATCCGCGGTGACTTCCGCACCACTGTCGAGTACCTCATCAAGCTGCTC
GAGACGGAGGACTTCGAGGAGAATACCATCTCGACCGGCTGGCTTGACGAGCTCATCTCCAAGCGGCTGACCGCC
GAGCGTCCGGATCCCATGCTCGCCGTAGTCTGCGGCGCCACCACAAAGGCCCACATCGCCAGCGAAGCCTGCCTC
GCCGAATATCGAGCCGGCCTCGAAAAGGGCCAGGTGCCGTCCAAGGAGATCCTCAAGACAGTCTTCACCATCGAC
TTCATCTACGAGGGCTTCCGTTACAAGTTCACGGCCACGCGTGCCAGCGCCGACAGCTACCACCTCTTCATCAAC
GGCTCCAAGTGCTCTGTCGGCGTCCGCGCCCTCAGCGACGGCGGCCTGCTCATCCTCCTGGACGGCCACAGCCAC
AACGTCTACTGGAAGGAAGAGGTCGGCGCCACCCGTCTCTCGGTCGACAGCAAGACGTGTCTCCTCGAGCAGGAG
AACGACCCGACACAGCTGCGGTCCCCAAGCCCCGGCAAGCTCGTCAAGTACACGGTCGAGAACGGGGCCCACGTC
AAGGCCGGCCAGACGTTCGCCGAGGTCGAGGTTATGAAGATGTACATGCCTCTCATTGCCCAGGAGGACGGCATT
GTTCAGCTCATCAAGCAGCCTGGCGCCACCCTCGAGGCCGGCGACATCCTCGGTATCCTCGCCCTCGACGACCCC
AGCCGCGTCAAGCAGGCCCAGGCCTTCGTCGACAAGCTTCCGGCCTACGGGGAGCCCGTCGTCGTCGGCAACAAG
CCCGCTCAGCGCTTCAGCGTCCTGCGCGACATCATCACCAATATCCTCATGGGCTACGACAATTCGGTCATCATG
GCGCCCGCTCTCAAGGAGCTGATTGAGGTGCTACGGAACCCGGAGCTGCCTTACAGCGAGTGGAACGCCTGTTTC
TCTGCCCTGCACGCGCGCATGCCCCAGAAGCTCGACGCTCAGCTGGTTCAGGTTGTTGAGCGCGCGAGGGCGCGT
CATGCCGAGTTCCCGGCCAGGACCCTCATCAAGGCTCTGCACAAGTTCATGGAGGAGAGCGTGGCCGACGCCGAC
GTCGACCTGCTCAAGGTGACGCTCGCGCCCTTGTTGGAGATTTTGACGCAGTACGCCGACGGACAAAAGGTCCGC
GAACTCAACTTCATCGACAGCCTGCTGGGCACATATTGGGACGTCGAGAAGCTCTTTGTCGGCCAGGTGCAGGAG
GATGCCGTCGTTCTCAAGCTGCGCGACCAGAATAAGGATAACATCAACAAGGTGCTCCAGATCGTGCTGTCGCAT
AGCCGCGTCAGCGCAAAGAGCTCTCTCATGCTCGCCATCCTCGACGAGTACCGGCCCAACAGGCCCAACGTGGGC
AACATTGGAAAATATCTGCGCGACTCGCTTCGCAGGCTGACGGAGCTCTCATCGCGGCCCACGTCCAAGGTGTCT
CTCAAAGCTCGCGAGATTATGATCCAGTGCTCGCTTCCGTCACTGGAGGAGCGGACCGCGCAGCTGGAGCACATC
CTCCGCTCGTCGGTGGTCGAGTCGCGCTACGGCGAGAGCGGTTGGGACCACCGCGAGCCCAATCTCGATGTCATC
AAGGAGGTGGTCGACTCCAAGTACACCGTCTTTGACGTGCTTCCGCTCTTCTTCGCCCACGAAGATCCGTGGGTA
GCGCTGGCGTCGCTCGAGGTCTACGTCCGCCGCTCGTATCGCGCCTACGTGCTGCAGCAGATCGAGTACCACAAC
GACGAGTCGGATCTGCCCCTTTTCGTCTCGTGGGATTTCCAGCTTCGCAAGCTGGGCCAGTCCGAATTCGGCCTG
CCGCTCATGTCGGCCGCGCCCTCGACGCCCGGCACGCCCGTGACGCCCGCAAACAACTCGAGGCCCTTTATGAAC
CGCATCTCGTCCATCAGCGACATGTCGTACCTCAGCAGCAAATGGGACGAGGAGCCGACGCGCAAGGGCATCATC
GCGCCCTGCAGGTATCTCGACGACGCCGAGGACATGATCCAAAAGGCGCTCGAGACCCTCGCCGTCCACAACAAG
CAGAAGAAGCTCAACAACGGCACCAACATCCTGGCCGAGCTCAACGGCAAGCGCAAGCCCTCGTCGGCCATGAAA
CAGGATGTGAGGAAGGGAGACGAGCTGTCCGCCGTCATCAACATCGCCGTGCGCGACGCCGAGACGCGTGACGAC
GAGGAGATCATGTCTCGCATCCTGCCCGTCGTCGAGCAGTTCAAGGGCGACATGCTCGCGCGCGGCGTCCGACGC
CTCACCTTCATCTGCGGCCACAGCGACGGCGGATACCCTGGCTACTACACGTTCCGCGGCCCCGAGTACAACGAG
GACGATAGCATCCGTCACAGCGAGCCGGCCCTGGCTTTCCAGCTTGAGCTGGGACGCCTAGCAAAGTTCGGCATC
AAGCCCGTCTTTACGCAGAACAAGAACATTCACGTGTACGAGGCCGTCGGAAAGGCCGTCGACACAGATAAGCGC
TACTTCACCCGCGCCGTGATCCGACCCGGGCGCCTGCGCGATGAGATCCCGACTGCCGAATACCTCATCTCCGAG
GCGGACCGCGTCATCAACGACATCTTTGACGCGCTCGAGATCATTGGCAACAACTCGTCGGACCTGAACCACATC
TTCATGAACTTCACGCCCGTCTTCCAGCTGGACCCGCAGCAGGTCGAGAAGAGCCTGCAGGGTTTCCTGGACCGC
TTCGGTCCCCGGGGCTGGCGGCTGCGCGTGTCGCAGGTCGAGATCCGCATCATCTGTACGGATCCGACAACCAGC
ACGCCCTATCCCCTCCGCGTCGTCGTCACCAACACGTCGGGCTACATCGTTGACGTCGACATGTACGCGGAGCGA
AAGTCGGAGAAGGGCGAGTGGCTCTTCCACAGCATTGGTGGCACCAAGGAGAAGGGCCCGCTGCATCTGCTGTCC
GTCTCGACGCCCTACGCCACCAAGAACGCCCTCCAGCCGAAGCGTTATAAGGCGCACCTCATGGGCACGCAGTAC
GTCTACGACTTCCCTGAGCTCTTCCGCCAGGCGATCCAGAACAGCTGGGCCAAGGCTGTGCAGAACCAGCCCACG
CTGGCGTCGCAGCGACCCAAGGTTGGCGAATGCATCACCTTTACCGAGCTCGTCCTCGACGAGCAGGATAACATT
GACGAGGTGAACCGCGAGCCCGGCACCAACACGTGCGGCATGGTCGGCTGGATCTTCCGGGCACGCACCCCCGAA
TACCCGGCCGGGCGGCGCTTCGTCGTCATCGCCAACGACATCACGTACAAAATCGGGTCCTTTGGGCCCAAGGAA
GACAACTTCTTCCACAAGTGTACCGAGCTCGCCCGCAGGCTGGGCATTCCACGCATCTACCTGTCGGCCAACTCG
GGCGCGCGTCTGGGCCTGGCCGAGGAGCTGATCCCGCACTTCAAGGTGGCCTGGAACGACCCGGAGAAGCCCGAG
GCCGGGTTTCGCTATCTGTACCTCGACGACAAGACGAGGCAGGGCTTCAAAAAGGACGTCATCACCGAGGAGGTC
TCCGAGGGGGGCGAGAAGCGCCACCGGATCGTCACCATTGTCGGTCAGGAGGACGGGCTCGGCGTCGAGTGCCTC
AAGGGGTCTGGTCTCATTGCGGGCGCGACCAGTCGGGCCTATGAAGACATCTTCACGGTGACGCTGGTGACTTGC
CGGTCTGTTGGAATTGGCGCCTATCTCGTACGCCTCGGTCAACGAGCCGTGCAGATTGAAGGCCAGCCCATCATC
CTGACGGGCGCCCCGGCCCTCAACAATCTGCTCGGTCGCGAAGTGTACACGTCCAATCTGCAGCTCGGCGGCACG
CAGATCATGTACCGCAACGGCGTCTCCCACATGACGGCCAACGACGACTTTGCTGGCATCTCACGCATCGTCGAA
TGGATGTCGTTTGTGCCCGAGAAGCGCAACGGCCCTGTGCCCATCAGCCCGAGCGTCGACGACTGGAATCGCGAC
GTGACGTACTGCCCGCCGCAGAAGCAGCCGTACGACGTGCGGTGGATGATTGCCGGCAAGGAGGACGAGGACGGC
GGCTTCCTCAGCGGCCTCTTCGACCGGGACTCGTTCGTCGAGGCGCTCGGAGGCTGGGCGCGAACGGTCGTGGTG
GGCCGGGCGCGGCTGGGGGGCATCCCCATGGGCGTCATCGGCGTCGAGACGCGGTCGGTGGAGAACATCACGCCG
GCCGACCCGGCCAACCCCGACTCGATGGAGCAGGTGAGCAACGAGGCCGGTGGCGTGTGGTATCCCAACTCGGCC
TTCAAGACGGCGCAGGCCATCAACGACTTCAACAAGGGCGAGCAGCTGCCATTGATGATTCTGGCCAATTGGCGC
GGCTTCTCAGGCGGGCAGCGCGACATGTACAACGAAGTGCTCAAGTACGGGTCCTTCATCGTCGACGCGCTCGTC
AAGTTTGAGCAGCCCATCTTTGTGTACGTGCCGCCGTTTGGCGAGCTACGTGGTGGATCGTGGGTCGTCGTCGAC
CCGACCATCAACCCGACCGTCATGGAGATGTACGCCGACAACGAGGCGCGGGGCGGCGTGCTGGAGCCCGAAGGC
ATGATCGGAATCAAGTTCCGCAAGGAAAAGCAGCTGGAGACGATGGCGCGCCTGGACCCGACCTATGCCGGCCTC
AAGCGTCGACTGGAAGACAAGAGCCTGAGCGCCGAGGAGGCGGCCGAGGTCAAGTCGAAGATGACGATACGGGAA
AAGATGCTGCTGCCGGTATATGCACAGGTGGCGGTGCAGTTCGCGGACCTGCACGATCGGGCCGGGCGGATGAAG
GCCAAGGGCGCGATCCGGGACTCGCTGTCGTGGATCAACGCCCGCCGCTTCTTCTACTGGAGGCTGCGACGACGG
CTCAACGAGGAGTATATCCTGAAGCGCATGGCGAGCAAGGACGCCAACAACAACCAGGTCAAGGCGGCCGAGGCG
CGGGCGCGGAATATGCTGTTACTAGAGAGCTGGTCGGGCATCACAGGCTGGGGCCACAACGATCGCGAGGTGGCC
GAATGGTACGAGAAGGAGCGAAAGTCGATTGGGGAGAAGGTGGAGGCTCTCAAAGCGGAGAAGGTGTCGGCCGAG
GTGTCGGAGGCAGTGCGCAGTCACAAGGACGCCGGTTGGAAGGGGGTGCGCGAGGTGTTGAGGGTGATGCCGACG
GAGGAGCGGGAGGCGATGCTCAAGTATCTCAGAGGGTGA
Transcript >Ophcf2|06939
ATGGTGTCAGCGACGCCTGTCGCCACAAACGGCACCAATGGCCGCACTGTTCCCGTCTCCAACGGAAAGGCGTCC
TACGCGGAGAAGCACGCCGTTGCTGACCACTTCATCGGCGGCAACGCGCTGGCTAATGCCCCGGCCGGCAAGGTC
AAGGACTTTGTCGCCCAAAACGATGGCCACACCGTTATCACAAACGTACTCATAGCAAATAACGGCATCGCTGCC
GTCAAGGAGATCCGCTCCGTCCGGAAATGGGCGTACGAGACGTTTGGCGACGAGCGTGCCATCCATTTCACCGTC
ATGGCTACCCCCGAGGATCTTCAGGCCAACGCAGACTATATCCGCATGGCCGATCACTACGTCGAGGTCCCGGGC
GGCACCAACAACCACAACTACGCCAACGTGGAGCTAATAGTTGACATTGCCGAGCGGATGAACGTACACGCCGTC
TGGGCCGGCTGGGGCCACGCTTCTGAGAACCCCAAGCTGCCAGAGTCGCTGGCAGCCTCTCCAAATAAGATAGTC
TTCATCGGTCCCCCGGGATCCGCCATGAGGTCTCTGGGTGATAAAATCTCGTCCACCATCGTTGCCCAGCACGCC
CTCGTACCATGCATACCATGGTCTGGCACGGGCGTCAACGCCGTCGATATCGACGCAAAGGGCATCGTCACCGTC
CCCGATAACGTCTACGCCAAGGGCTGCGTCACTTCATGGCAGGAAGGTCTGGAAAAGGCAAAGGAGATTGGCTTT
CCCGTCATGATCAAGGCCTCAGAAGGCGGCGGCGGTAAGGGCATCCGCAAAGCTACCAACGAGGACGAGTTCGAG
GCCCTATACAAGGCGGCAGCCAGCGAGATCCCCGGCTCGCCCATTTTCATCATGAAGCTGGCCGGCAACGCGCGT
CATCTCGAAGTCCAGCTGCTGGCTGACCAATATGGCAACAACATCTCCCTGTTTGGTCGTGACTGCTCTGTTCAG
CGGCGTCATCAGAAGATTATCGAGGAGGCGCCCGTCACCATCGCAAAGGCCGACACCTTCAAGGCCATGGAGGAC
GCCGCCGTCCGGCTCGGCAAGCTGGTGGGCTACGTCTCGGCCGGCACCGTCGAATATCTATACTCGCACGCCGAC
GACAAATTCTACTTCCTCGAGCTCAACCCGCGTTTGCAGGTCGAGCATCCGACGACGGAAATGGTCAGCGGCGTC
AACCTGCCCGCCGCCCAGCTCCAGATCGCCATGGGCGTGCCGCTGCACCGCGTCCGCGACATCAGGCTGCTCTAC
GGCGTCGACCCCAAGGCCTCGAGTCTCATCGACTTTGAGTTCAAGCAGCACGGCACCGCTCAGTCTCAGCGCCGC
CCGACGCCCACTGGCCATACCACCGCCTGCCGCATCACCTCTGAGGACCCGGGTGAGGGCTTCAAGCCCTCCAAC
GGCGTCATGCACGAGCTCAACTTCAGGAGCAGCTCCAATGTCTGGGGCTACTTCTCCGTCGGCACCCAGGGTGGT
ATCCACAGCTTCTCCGACAGCCAGTTCGGCCATATTTTCGCCTACGGCGAGAACCGCCAGGCCTCGCGCAAGCAC
ATGGTCATCGCCCTGAAGGAGCTCAGCATCCGCGGTGACTTCCGCACCACTGTCGAGTACCTCATCAAGCTGCTC
GAGACGGAGGACTTCGAGGAGAATACCATCTCGACCGGCTGGCTTGACGAGCTCATCTCCAAGCGGCTGACCGCC
GAGCGTCCGGATCCCATGCTCGCCGTAGTCTGCGGCGCCACCACAAAGGCCCACATCGCCAGCGAAGCCTGCCTC
GCCGAATATCGAGCCGGCCTCGAAAAGGGCCAGGTGCCGTCCAAGGAGATCCTCAAGACAGTCTTCACCATCGAC
TTCATCTACGAGGGCTTCCGTTACAAGTTCACGGCCACGCGTGCCAGCGCCGACAGCTACCACCTCTTCATCAAC
GGCTCCAAGTGCTCTGTCGGCGTCCGCGCCCTCAGCGACGGCGGCCTGCTCATCCTCCTGGACGGCCACAGCCAC
AACGTCTACTGGAAGGAAGAGGTCGGCGCCACCCGTCTCTCGGTCGACAGCAAGACGTGTCTCCTCGAGCAGGAG
AACGACCCGACACAGCTGCGGTCCCCAAGCCCCGGCAAGCTCGTCAAGTACACGGTCGAGAACGGGGCCCACGTC
AAGGCCGGCCAGACGTTCGCCGAGGTCGAGGTTATGAAGATGTACATGCCTCTCATTGCCCAGGAGGACGGCATT
GTTCAGCTCATCAAGCAGCCTGGCGCCACCCTCGAGGCCGGCGACATCCTCGGTATCCTCGCCCTCGACGACCCC
AGCCGCGTCAAGCAGGCCCAGGCCTTCGTCGACAAGCTTCCGGCCTACGGGGAGCCCGTCGTCGTCGGCAACAAG
CCCGCTCAGCGCTTCAGCGTCCTGCGCGACATCATCACCAATATCCTCATGGGCTACGACAATTCGGTCATCATG
GCGCCCGCTCTCAAGGAGCTGATTGAGGTGCTACGGAACCCGGAGCTGCCTTACAGCGAGTGGAACGCCTGTTTC
TCTGCCCTGCACGCGCGCATGCCCCAGAAGCTCGACGCTCAGCTGGTTCAGGTTGTTGAGCGCGCGAGGGCGCGT
CATGCCGAGTTCCCGGCCAGGACCCTCATCAAGGCTCTGCACAAGTTCATGGAGGAGAGCGTGGCCGACGCCGAC
GTCGACCTGCTCAAGGTGACGCTCGCGCCCTTGTTGGAGATTTTGACGCAGTACGCCGACGGACAAAAGGTCCGC
GAACTCAACTTCATCGACAGCCTGCTGGGCACATATTGGGACGTCGAGAAGCTCTTTGTCGGCCAGGTGCAGGAG
GATGCCGTCGTTCTCAAGCTGCGCGACCAGAATAAGGATAACATCAACAAGGTGCTCCAGATCGTGCTGTCGCAT
AGCCGCGTCAGCGCAAAGAGCTCTCTCATGCTCGCCATCCTCGACGAGTACCGGCCCAACAGGCCCAACGTGGGC
AACATTGGAAAATATCTGCGCGACTCGCTTCGCAGGCTGACGGAGCTCTCATCGCGGCCCACGTCCAAGGTGTCT
CTCAAAGCTCGCGAGATTATGATCCAGTGCTCGCTTCCGTCACTGGAGGAGCGGACCGCGCAGCTGGAGCACATC
CTCCGCTCGTCGGTGGTCGAGTCGCGCTACGGCGAGAGCGGTTGGGACCACCGCGAGCCCAATCTCGATGTCATC
AAGGAGGTGGTCGACTCCAAGTACACCGTCTTTGACGTGCTTCCGCTCTTCTTCGCCCACGAAGATCCGTGGGTA
GCGCTGGCGTCGCTCGAGGTCTACGTCCGCCGCTCGTATCGCGCCTACGTGCTGCAGCAGATCGAGTACCACAAC
GACGAGTCGGATCTGCCCCTTTTCGTCTCGTGGGATTTCCAGCTTCGCAAGCTGGGCCAGTCCGAATTCGGCCTG
CCGCTCATGTCGGCCGCGCCCTCGACGCCCGGCACGCCCGTGACGCCCGCAAACAACTCGAGGCCCTTTATGAAC
CGCATCTCGTCCATCAGCGACATGTCGTACCTCAGCAGCAAATGGGACGAGGAGCCGACGCGCAAGGGCATCATC
GCGCCCTGCAGGTATCTCGACGACGCCGAGGACATGATCCAAAAGGCGCTCGAGACCCTCGCCGTCCACAACAAG
CAGAAGAAGCTCAACAACGGCACCAACATCCTGGCCGAGCTCAACGGCAAGCGCAAGCCCTCGTCGGCCATGAAA
CAGGATGTGAGGAAGGGAGACGAGCTGTCCGCCGTCATCAACATCGCCGTGCGCGACGCCGAGACGCGTGACGAC
GAGGAGATCATGTCTCGCATCCTGCCCGTCGTCGAGCAGTTCAAGGGCGACATGCTCGCGCGCGGCGTCCGACGC
CTCACCTTCATCTGCGGCCACAGCGACGGCGGATACCCTGGCTACTACACGTTCCGCGGCCCCGAGTACAACGAG
GACGATAGCATCCGTCACAGCGAGCCGGCCCTGGCTTTCCAGCTTGAGCTGGGACGCCTAGCAAAGTTCGGCATC
AAGCCCGTCTTTACGCAGAACAAGAACATTCACGTGTACGAGGCCGTCGGAAAGGCCGTCGACACAGATAAGCGC
TACTTCACCCGCGCCGTGATCCGACCCGGGCGCCTGCGCGATGAGATCCCGACTGCCGAATACCTCATCTCCGAG
GCGGACCGCGTCATCAACGACATCTTTGACGCGCTCGAGATCATTGGCAACAACTCGTCGGACCTGAACCACATC
TTCATGAACTTCACGCCCGTCTTCCAGCTGGACCCGCAGCAGGTCGAGAAGAGCCTGCAGGGTTTCCTGGACCGC
TTCGGTCCCCGGGGCTGGCGGCTGCGCGTGTCGCAGGTCGAGATCCGCATCATCTGTACGGATCCGACAACCAGC
ACGCCCTATCCCCTCCGCGTCGTCGTCACCAACACGTCGGGCTACATCGTTGACGTCGACATGTACGCGGAGCGA
AAGTCGGAGAAGGGCGAGTGGCTCTTCCACAGCATTGGTGGCACCAAGGAGAAGGGCCCGCTGCATCTGCTGTCC
GTCTCGACGCCCTACGCCACCAAGAACGCCCTCCAGCCGAAGCGTTATAAGGCGCACCTCATGGGCACGCAGTAC
GTCTACGACTTCCCTGAGCTCTTCCGCCAGGCGATCCAGAACAGCTGGGCCAAGGCTGTGCAGAACCAGCCCACG
CTGGCGTCGCAGCGACCCAAGGTTGGCGAATGCATCACCTTTACCGAGCTCGTCCTCGACGAGCAGGATAACATT
GACGAGGTGAACCGCGAGCCCGGCACCAACACGTGCGGCATGGTCGGCTGGATCTTCCGGGCACGCACCCCCGAA
TACCCGGCCGGGCGGCGCTTCGTCGTCATCGCCAACGACATCACGTACAAAATCGGGTCCTTTGGGCCCAAGGAA
GACAACTTCTTCCACAAGTGTACCGAGCTCGCCCGCAGGCTGGGCATTCCACGCATCTACCTGTCGGCCAACTCG
GGCGCGCGTCTGGGCCTGGCCGAGGAGCTGATCCCGCACTTCAAGGTGGCCTGGAACGACCCGGAGAAGCCCGAG
GCCGGGTTTCGCTATCTGTACCTCGACGACAAGACGAGGCAGGGCTTCAAAAAGGACGTCATCACCGAGGAGGTC
TCCGAGGGGGGCGAGAAGCGCCACCGGATCGTCACCATTGTCGGTCAGGAGGACGGGCTCGGCGTCGAGTGCCTC
AAGGGGTCTGGTCTCATTGCGGGCGCGACCAGTCGGGCCTATGAAGACATCTTCACGGTGACGCTGGTGACTTGC
CGGTCTGTTGGAATTGGCGCCTATCTCGTACGCCTCGGTCAACGAGCCGTGCAGATTGAAGGCCAGCCCATCATC
CTGACGGGCGCCCCGGCCCTCAACAATCTGCTCGGTCGCGAAGTGTACACGTCCAATCTGCAGCTCGGCGGCACG
CAGATCATGTACCGCAACGGCGTCTCCCACATGACGGCCAACGACGACTTTGCTGGCATCTCACGCATCGTCGAA
TGGATGTCGTTTGTGCCCGAGAAGCGCAACGGCCCTGTGCCCATCAGCCCGAGCGTCGACGACTGGAATCGCGAC
GTGACGTACTGCCCGCCGCAGAAGCAGCCGTACGACGTGCGGTGGATGATTGCCGGCAAGGAGGACGAGGACGGC
GGCTTCCTCAGCGGCCTCTTCGACCGGGACTCGTTCGTCGAGGCGCTCGGAGGCTGGGCGCGAACGGTCGTGGTG
GGCCGGGCGCGGCTGGGGGGCATCCCCATGGGCGTCATCGGCGTCGAGACGCGGTCGGTGGAGAACATCACGCCG
GCCGACCCGGCCAACCCCGACTCGATGGAGCAGGTGAGCAACGAGGCCGGTGGCGTGTGGTATCCCAACTCGGCC
TTCAAGACGGCGCAGGCCATCAACGACTTCAACAAGGGCGAGCAGCTGCCATTGATGATTCTGGCCAATTGGCGC
GGCTTCTCAGGCGGGCAGCGCGACATGTACAACGAAGTGCTCAAGTACGGGTCCTTCATCGTCGACGCGCTCGTC
AAGTTTGAGCAGCCCATCTTTGTGTACGTGCCGCCGTTTGGCGAGCTACGTGGTGGATCGTGGGTCGTCGTCGAC
CCGACCATCAACCCGACCGTCATGGAGATGTACGCCGACAACGAGGCGCGGGGCGGCGTGCTGGAGCCCGAAGGC
ATGATCGGAATCAAGTTCCGCAAGGAAAAGCAGCTGGAGACGATGGCGCGCCTGGACCCGACCTATGCCGGCCTC
AAGCGTCGACTGGAAGACAAGAGCCTGAGCGCCGAGGAGGCGGCCGAGGTCAAGTCGAAGATGACGATACGGGAA
AAGATGCTGCTGCCGGTATATGCACAGGTGGCGGTGCAGTTCGCGGACCTGCACGATCGGGCCGGGCGGATGAAG
GCCAAGGGCGCGATCCGGGACTCGCTGTCGTGGATCAACGCCCGCCGCTTCTTCTACTGGAGGCTGCGACGACGG
CTCAACGAGGAGTATATCCTGAAGCGCATGGCGAGCAAGGACGCCAACAACAACCAGGTCAAGGCGGCCGAGGCG
CGGGCGCGGAATATGCTGTTACTAGAGAGCTGGTCGGGCATCACAGGCTGGGGCCACAACGATCGCGAGGTGGCC
GAATGGTACGAGAAGGAGCGAAAGTCGATTGGGGAGAAGGTGGAGGCTCTCAAAGCGGAGAAGGTGTCGGCCGAG
GTGTCGGAGGCAGTGCGCAGTCACAAGGACGCCGGTTGGAAGGGGGTGCGCGAGGTGTTGAGGGTGATGCCGACG
GAGGAGCGGGAGGCGATGCTCAAGTATCTCAGAGGGTGA
Gene >Ophcf2|06939
ATGGTGTCAGCGACGCCTGTCGCCACAAACGGCACCAATGGCCGCACTGTTCCCGTCTCCAACGGAAAGGCGTCC
TACGCGGAGAAGCACGCCGTTGCTGACCACTTCATCGGCGGCAACGCGCTGGCTAATGCCCCGGCCGGCAAGGTC
AAGGACTTTGTCGCCCAAAACGATGGCCACACCGTTATCACAAACGTGGGAACTTGCTCTGGCCAAATCGTGCCG
GCCTGCTTGCTCACTCATCCTCGCAGGTACTCATAGCAAATAACGGCATCGCTGCCGTCAAGGAGATCCGCTCCG
TCCGGAAATGGGCGTACGAGACGTTTGGCGACGAGCGTGCCATCCATTTCACCGTCATGGCTACCCCCGAGGATC
TTCAGGCCAACGCAGACTATATCCGCATGGCCGATCACTACGTCGAGGTCCCGGGCGGCACCAACAACCACAACT
ACGCCAACGTGGAGCTAATAGTTGACATTGCCGAGCGGATGAACGTACACGCCGTCTGGGCCGGCTGGTGATTTT
ATCCCGATACCACTTCCCGATGCAGAGCGCTGACTGCCGTCTCAGGGGCCACGCTTCTGAGAACCCCAAGCTGCC
AGAGTCGCTGGCAGCCTCTCCAAATAAGATAGTCTTCATCGGTCCCCCGGGATCCGCCATGAGGTCTCTGGGTGA
TAAAATCTCGTCCACCATCGTTGCCCAGCACGCCCTCGTACCATGCATACCATGGTCTGGCACGGGCGTCAACGC
CGTCGATATCGACGCAAAGGGCATCGTCACCGTCCCCGATAACGTCTACGCCAAGGGCTGCGTCACTTCATGGCA
GGAAGGTCTGGAAAAGGCAAAGGAGATTGGCTTTCCCGTCATGATCAAGGCCTCAGAAGGCGGCGGCGGTAAGGG
CATCCGCAAAGCTACCAACGAGGACGAGTTCGAGGCCCTATACAAGGCGGCAGCCAGCGAGATCCCCGGCTCGCC
CATTTTCATCATGAAGCTGGCCGGCAACGCGCGTCATCTCGAAGTCCAGCTGCTGGCTGACCAATATGGCAACAA
CATCTCCCTGTTTGGTCGTGACTGCTCTGTTCAGCGGCGTCATCAGAAGATTATCGAGGAGGCGCCCGTCACCAT
CGCAAAGGCCGACACCTTCAAGGCCATGGAGGACGCCGCCGTCCGGCTCGGCAAGCTGGTGGGCTACGTCTCGGC
CGGCACCGTCGAATATCTATACTCGCACGCCGACGACAAATTCTACTTCCTCGAGCTCAACCCGCGTTTGCAGGT
CGAGCATCCGACGACGGAAATGGTCAGCGGCGTCAACCTGCCCGCCGCCCAGCTCCAGATCGCCATGGGCGTGCC
GCTGCACCGCGTCCGCGACATCAGGCTGCTCTACGGCGTCGACCCCAAGGCCTCGAGTCTCATCGACTTTGAGTT
CAAGCAGCACGGCACCGCTCAGTCTCAGCGCCGCCCGACGCCCACTGGCCATACCACCGCCTGCCGCATCACCTC
TGAGGACCCGGGTGAGGGCTTCAAGCCCTCCAACGGCGTCATGCACGAGCTCAACTTCAGGAGCAGCTCCAATGT
CTGGGGCTACTTCTCCGTCGGCACCCAGGGTGGTATCCACAGCTTCTCCGACAGCCAGTTCGGCCATATTTTCGC
CTACGGCGAGAACCGCCAGGCCTCGCGCAAGCACATGGTCATCGCCCTGAAGGAGCTCAGCATCCGCGGTGACTT
CCGCACCACTGTCGAGTACCTCATCAAGCTGCTCGAGACGGAGGACTTCGAGGAGAATACCATCTCGACCGGCTG
GCTTGACGAGCTCATCTCCAAGCGGCTGACCGCCGAGCGTCCGGATCCCATGCTCGCCGTAGTCTGCGGCGCCAC
CACAAAGGCCCACATCGCCAGCGAAGCCTGCCTCGCCGAATATCGAGCCGGCCTCGAAAAGGGCCAGGTGCCGTC
CAAGGAGATCCTCAAGACAGTCTTCACCATCGACTTCATCTACGAGGGCTTCCGTTACAAGTTCACGGCCACGCG
TGCCAGCGCCGACAGCTACCACCTCTTCATCAACGGCTCCAAGTGCTCTGTCGGCGTCCGCGCCCTCAGCGACGG
CGGCCTGCTCATCCTCCTGGACGGCCACAGCCACAACGTCTACTGGAAGGAAGAGGTCGGCGCCACCCGTCTCTC
GGTCGACAGCAAGACGTGTCTCCTCGAGCAGGAGAACGACCCGACACAGCTGCGGTCCCCAAGCCCCGGCAAGCT
CGTCAAGTACACGGTCGAGAACGGGGCCCACGTCAAGGCCGGCCAGACGTTCGCCGAGGTCGAGGTTATGAAGAT
GTACATGCCTCTCATTGCCCAGGAGGACGGCATTGTTCAGCTCATCAAGCAGCCTGGCGCCACCCTCGAGGCCGG
CGACATCCTCGGTATCCTCGCCCTCGACGACCCCAGCCGCGTCAAGCAGGCCCAGGCCTTCGTCGACAAGCTTCC
GGCCTACGGGGAGCCCGTCGTCGTCGGCAACAAGCCCGCTCAGCGCTTCAGCGTCCTGCGCGACATCATCACCAA
TATCCTCATGGGCTACGACAATTCGGTCATCATGGCGCCCGCTCTCAAGGAGCTGATTGAGGTGCTACGGAACCC
GGAGCTGCCTTACAGCGAGTGGAACGCCTGTTTCTCTGCCCTGCACGCGCGCATGCCCCAGAAGCTCGACGCTCA
GCTGGTTCAGGTTGTTGAGCGCGCGAGGGCGCGTCATGCCGAGTTCCCGGCCAGGACCCTCATCAAGGCTCTGCA
CAAGTTCATGGAGGAGAGCGTGGCCGACGCCGACGTCGACCTGCTCAAGGTGACGCTCGCGCCCTTGTTGGAGAT
TTTGACGCAGTACGCCGACGGACAAAAGGTCCGCGAACTCAACTTCATCGACAGCCTGCTGGGCACATATTGGGA
CGTCGAGAAGCTCTTTGTCGGCCAGGTGCAGGAGGATGCCGTCGTTCTCAAGCTGCGCGACCAGAATAAGGATAA
CATCAACAAGGTGCTCCAGATCGTGCTGTCGCATAGCCGCGTCAGCGCAAAGAGCTCTCTCATGCTCGCCATCCT
CGACGAGTACCGGCCCAACAGGCCCAACGTGGGCAACATTGGAAAATATCTGCGCGACTCGCTTCGCAGGCTGAC
GGAGCTCTCATCGCGGCCCACGTCCAAGGTGTCTCTCAAAGCTCGCGAGATTATGATCCAGTGCTCGCTTCCGTC
ACTGGAGGAGCGGACCGCGCAGCTGGAGCACATCCTCCGCTCGTCGGTGGTCGAGTCGCGCTACGGCGAGAGCGG
TTGGGACCACCGCGAGCCCAATCTCGATGTCATCAAGGAGGTGGTCGACTCCAAGTACACCGTCTTTGACGTGCT
TCCGCTCTTCTTCGCCCACGAAGATCCGTGGGTAGCGCTGGCGTCGCTCGAGGTCTACGTCCGCCGCTCGTATCG
CGCCTACGTGCTGCAGCAGATCGAGTACCACAACGACGAGTCGGATCTGCCCCTTTTCGTCTCGTGGGATTTCCA
GCTTCGCAAGCTGGGCCAGTCCGAATTCGGCCTGCCGCTCATGTCGGCCGCGCCCTCGACGCCCGGCACGCCCGT
GACGCCCGCAAACAACTCGAGGCCCTTTATGAACCGCATCTCGTCCATCAGCGACATGTCGTACCTCAGCAGCAA
ATGGGACGAGGAGCCGACGCGCAAGGGCATCATCGCGCCCTGCAGGTATCTCGACGACGCCGAGGACATGATCCA
AAAGGCGCTCGAGACCCTCGCCGTCCACAACAAGCAGAAGAAGCTCAACAACGGCACCAACATCCTGGCCGAGCT
CAACGGCAAGCGCAAGCCCTCGTCGGCCATGAAACAGGATGTGAGGAAGGGAGACGAGCTGTCCGCCGTCATCAA
CATCGCCGTGCGCGACGCCGAGACGCGTGACGACGAGGAGATCATGTCTCGCATCCTGCCCGTCGTCGAGCAGTT
CAAGGGCGACATGCTCGCGCGCGGCGTCCGACGCCTCACCTTCATCTGCGGCCACAGCGACGGCGGATACCCTGG
CTACTACACGTTCCGCGGCCCCGAGTACAACGAGGACGATAGCATCCGTCACAGCGAGCCGGCCCTGGCTTTCCA
GCTTGAGCTGGGACGCCTAGCAAAGTTCGGCATCAAGCCCGTCTTTACGCAGAACAAGAACATTCACGTGTACGA
GGCCGTCGGAAAGGCCGTCGACACAGATAAGCGCTACTTCACCCGCGCCGTGATCCGACCCGGGCGCCTGCGCGA
TGAGATCCCGACTGCCGAATACCTCATCTCCGAGGCGGACCGCGTCATCAACGACATCTTTGACGCGCTCGAGAT
CATTGGCAACAACTCGTCGGACCTGAACCACATCTTCATGAACTTCACGCCCGTCTTCCAGCTGGACCCGCAGCA
GGTCGAGAAGAGCCTGCAGGGTTTCCTGGACCGCTTCGGTCCCCGGGGCTGGCGGCTGCGCGTGTCGCAGGTCGA
GATCCGCATCATCTGTACGGATCCGACAACCAGCACGCCCTATCCCCTCCGCGTCGTCGTCACCAACACGTCGGG
CTACATCGTTGACGTCGACATGTACGCGGAGCGAAAGTCGGAGAAGGGCGAGTGGCTCTTCCACAGCATTGGTGG
CACCAAGGAGAAGGGCCCGCTGCATCTGCTGTCCGTCTCGACGCCCTACGCCACCAAGAACGCCCTCCAGCCGAA
GCGTTATAAGGCGCACCTCATGGGCACGCAGTACGTCTACGACTTCCCTGAGCTCTTCCGCCAGGCGATCCAGAA
CAGCTGGGCCAAGGCTGTGCAGAACCAGCCCACGCTGGCGTCGCAGCGACCCAAGGTTGGCGAATGCATCACCTT
TACCGAGCTCGTCCTCGACGAGCAGGATAACATTGACGAGGTGAACCGCGAGCCCGGCACCAACACGTGCGGCAT
GGTCGGCTGGATCTTCCGGGCACGCACCCCCGAATACCCGGCCGGGCGGCGCTTCGTCGTCATCGCCAACGACAT
CACGTACAAAATCGGGTCCTTTGGGCCCAAGGAAGACAACTTCTTCCACAAGTGTACCGAGCTCGCCCGCAGGCT
GGGCATTCCACGCATCTACCTGTCGGCCAACTCGGGCGCGCGTCTGGGCCTGGCCGAGGAGCTGATCCCGCACTT
CAAGGTGGCCTGGAACGACCCGGAGAAGCCCGAGGCCGGGTTTCGCTATCTGTACCTCGACGACAAGACGAGGCA
GGGCTTCAAAAAGGACGTCATCACCGAGGAGGTCTCCGAGGGGGGCGAGAAGCGCCACCGGATCGTCACCATTGT
CGGTCAGGAGGACGGGCTCGGCGTCGAGTGCCTCAAGGGGTCTGGTCTCATTGCGGGCGCGACCAGTCGGGCCTA
TGAAGACATCTTCACGGTGACGCTGGTGACTTGCCGGTCTGTTGGTGAGTTTTACCCCTTTATATCTCGGCAGAA
TCCCCTGGGGGTTTATCAACAACGACGAGAGAGATTCTGACGAGCGAAACTGCAGGAATTGGCGCCTATCTCGTA
CGCCTCGGTCAACGAGCCGTGCAGATTGAAGGCCAGCCCATCATCCTGACGGGCGCCCCGGCCCTCAACAATCTG
CTCGGTCGCGAAGTGTACACGTCCAATCTGCAGCTCGGCGGCACGCAGATCATGTACCGCAACGGCGTCTCCCAC
ATGACGGCCAACGACGACTTTGCTGGCATCTCACGCATCGTCGAATGGATGTCGTTTGTGCCCGAGAAGCGCAAC
GGCCCTGTGCCCATCAGCCCGAGCGTCGACGACTGGAATCGCGACGTGACGTACTGCCCGCCGCAGAAGCAGCCG
TACGACGTGCGGTGGATGATTGCCGGCAAGGAGGACGAGGACGGCGGCTTCCTCAGCGGCCTCTTCGACCGGGAC
TCGTTCGTCGAGGCGCTCGGAGGCTGGGCGCGAACGGTCGTGGTGGGCCGGGCGCGGCTGGGGGGCATCCCCATG
GGCGTCATCGGCGTCGAGACGCGGTCGGTGGAGAACATCACGCCGGCCGACCCGGCCAACCCCGACTCGATGGAG
CAGGTGAGCAACGAGGCCGGTGGCGTGTGGTATCCCAACTCGGCCTTCAAGACGGCGCAGGCCATCAACGACTTC
AACAAGGGCGAGCAGCTGCCATTGATGATTCTGGCCAATTGGCGCGGCTTCTCAGGCGGGCAGCGCGACATGTAC
AACGAAGTGCTCAAGTACGGGTCCTTCATCGTCGACGCGCTCGTCAAGTTTGAGCAGCCCATCTTTGTGTACGTG
CCGCCGTTTGGCGAGCTACGTGGTGGATCGTGGGTCGTCGTCGACCCGACCATCAACCCGACCGTCATGGAGATG
TACGCCGACAACGAGGCGCGGGGCGGCGTGCTGGAGCCCGAAGGCATGATCGGAATCAAGTTCCGCAAGGAAAAG
CAGCTGGAGACGATGGCGCGCCTGGACCCGACCTATGCCGGCCTCAAGCGTCGACTGGAAGACAAGAGCCTGAGC
GCCGAGGAGGCGGCCGAGGTCAAGTCGAAGATGACGATACGGGAAAAGATGCTGCTGCCGGTATATGCACAGGTG
GCGGTGCAGTTCGCGGACCTGCACGATCGGGCCGGGCGGATGAAGGCCAAGGGCGCGATCCGGGACTCGCTGTCG
TGGATCAACGCCCGCCGCTTCTTCTACTGGAGGCTGCGACGACGGCTCAACGAGGAGTATATCCTGAAGCGCATG
GCGAGCAAGGACGCCAACAACAACCAGGTCAAGGCGGCCGAGGCGCGGGCGCGGAATATGCTGTTACTAGAGAGC
TGGTCGGGCATCACAGGCTGGGGCCACAACGATCGCGAGGTGGCCGAATGGTACGAGAAGGAGCGAAAGTCGATT
GGGGAGAAGGTGGAGGCTCTCAAAGCGGAGAAGGTGTCGGCCGAGGTGTCGGAGGCAGTGCGCAGTCACAAGGAC
GCCGGTTGGAAGGGGGTGCGCGAGGTGTTGAGGGTGATGCCGACGGAGGAGCGGGAGGCGATGCTCAAGTATCTC
AGAGGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail