Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06938
Gene name
Locationscaffold_09:35226..42967
Strand+
Gene length (bp)7741
Transcript length (bp)6603
Coding sequence length (bp)6603
Protein length (aa) 2201

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04880 NUDE_C NUDE protein, C-terminal conserved region 9.2E-42 1753 1892
PF12906 RINGv RING-variant domain 1.3E-16 36 82

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0043169 cation binding No
GO:0046914 transition metal ion binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0046872 metal ion binding No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.45

Transmembrane Domains

Domain # Start End Length
1 118 137 19
2 272 294 22
3 729 751 22
4 758 775 17
5 790 812 22
6 866 888 22
7 946 963 17
8 995 1017 22
9 1037 1059 22
10 1101 1123 22
11 1154 1176 22
12 1330 1352 22
13 1372 1391 19
14 1430 1452 22
15 1483 1505 22
16 1526 1548 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06938
MADATSDHKQPDQASHLKHGRSRVPAQALDAAPSICRICRGEGTAAEPLFYPCKCSGSIKYVHQDCLMEWLSHSQ
KKYCELCKTSFRFTKLYAPDMPKSLPVHVFVEHLGKYLLRNLLTWLRAVVTISVWACWLPYFMRSVWSFMFWVSD
EGLAGGSILSRSNDTDSTALWLSASAGICPASPLLAETTTSATEAAALLESLDSEDLTDYLLRIFFGSFGMPTKI
GRLHYGYPNVSSADGGFPASTPSASLLGNVGFLHNLTRSPTVNRTVVTVLEGQVITVLVIICFILVILVRDYVVQ
QQPEINMRAVFEEPGNELHPDGRNMVQAVAVEPAQQIQRPESDDEASDNADRQPLASVSEAAPGNIGEGSGIFDA
ENTALASAHAVTASGSGLDSVRDKIDSATVTSISHQGNSVSEPLPAPRHDTDDLAIQQGLEPFHEPGTWNDAALS
HVERSSQQSAPSGSEVQKFSEASEEPFQHRSSTESGAPDEKGKSRELASPRPAIELQPGPLRRRAASDGPTRRRA
ASDGPYHQPGMNPLGSNNWSFSRLPADGDSARPHEAIDAHAHQNDDLPTNSNSADEGSVLSSTATAHTRDDDNGE
LLPERGPAQEEDPPADDTALGDGLEPAGLVDRVAHFMWGDLEEHQEANQANLAGEDDATDDDGDGDGDDEDEDPW
VDVPMAEGVEENGDVDIEDVDGAVDGAGLDAEALDDLEDFEGVMELIGMRGPIAGLFQNAIFCAVLVSVTIFACI
FVPYNVGRIAFWVVANPMQLVRILFEFSKVVQDAVVMLGGLSSWFVLNLLDMFTGLLGGPLATKIVTVRKASWGL
WTGAGTRVMDYALLEFPISASEMHNFSAISHEALNTVKGSVMSAFLVVSGWLAALMTPSFYAIDEGSLAAAAAAV
GTTASRLKAALSLVLDPSSWVIDLSRTEARTPNPDLAYWSGLDRSWAILAGYLTIFAMGAMYLRRGTPFSRHNMV
QAWEAGVIDTLHQASGIMKVIVIISIEMLVFPLYCGLLLDAALLPLFENTTIRSRILFTYNFPLTSIFVHWFVGT
GYMFHFALFVSMCRKIMRPGVLYFIRDPDDPEFHPIRDVLERSLTTQLRKILFSAFVYGALVIVCLGGVVWSLSY
TLPGVLPIHYSSNEPVLEFPIDLLFYNFLMPQAVKVLRPGDGLHAMYTWWFRKCARGLRLTFFLFGERRVDEEGT
LQLELDVANSLPRYKRLFLELSEDNMVVPKTWSDTFEGGDAKPNPSLSSREERQLRRKKQHLVASGQLVRSGRFV
RAPASDRVNIPKSEPVLLPVTELGRRKDGKPDNDVYASSQYQMVYIPPNFRLRIFLFILFIWLFAAMTGVGITIA
PLALGRKMFKLLIPEHIRTNDIYAFSIGIYLLGTASYSILCVQKITTEVRAWVRRVWAEATRGHALVHAWNGLCS
VSRLLYAYACILILFPLLSSTLMELYITIPLHTYMDPPTAVSAPKQAGEGGRHTIRVIQAWTLGLLYLNLGTRMV
TSLFPESRAALAVRIMMRRGWLRPDVGILTRAFVMPGLALAALAMFAPPLTASLLIKMELLGKGSDGSGELAAIY
RHSYPAALLCVVVVKHAETCVRVRGLCSLCLWEYRFDSLSCKPWSLAMAEPPSSPPSEATSAEDALFWYKSQYEL
LESELAEFRESSRELEKELEKDIERAEKQERMFQEKAEALGFEVEEWKRKHKEAKTEAGAAQAALEKEITTLRDS
NRSLQLRLRDIEVANDDFERQARNTSSSLEDMESKYNQAIERGVMMEEEIKAGEQEREQLRIDSQRLREELADLK
IEAELMQDKIKKHEARHLSAISTDLSALGSPTFDKHPEESPDSSASSPLVTTPTETNKALSRASDVTDPPSPPMS
DASAPVQRVAEATARTKTPGRAVDGPPRKSRLPSLEGNATPKMRPRPSLGTATAPARAPGGRVSGVGVNVRTPSA
RQPKGRVAASHKIPASNSLSHIRSLTAQMQRLEARVQSARSKLPAPTTSSSPRASPRGSSLGHHVPSTVTIRSRK
RAVASSASSMAGDEEATPTNPRATRSHVPRLSTSGVGRLSFGPVPNRGPEPDMSRPSSRASHSSQARPASRTDMV
RPPRPISQTSVTRTPLGRPRSSLSGSLHSRSGSIGRAEEDEFRTPSRRGTYSKLETESGIPGPGSGIPTPSSRRQ
SGGRHTGRESAAGRHRKLSDLGETY*
Coding >Ophcf2|06938
ATGGCCGACGCCACCTCCGATCACAAGCAGCCTGACCAAGCTTCTCACCTCAAGCATGGCCGATCTAGGGTTCCG
GCTCAGGCGCTCGACGCAGCGCCATCCATCTGTCGCATATGTCGCGGCGAAGGCACCGCAGCTGAGCCTCTCTTT
TACCCTTGCAAATGCAGCGGCAGCATCAAGTACGTCCATCAGGATTGTCTGATGGAGTGGTTGTCGCATTCCCAG
AAGAAATACTGCGAGCTTTGCAAGACTTCGTTCCGCTTCACCAAGCTCTATGCACCCGACATGCCAAAATCTCTC
CCCGTCCACGTTTTCGTCGAGCATCTGGGCAAGTATCTGTTGCGGAACCTTTTGACGTGGCTTCGAGCCGTCGTC
ACCATCAGCGTATGGGCATGCTGGCTGCCCTATTTCATGCGCTCTGTCTGGTCCTTTATGTTCTGGGTCAGCGAC
GAGGGCCTTGCCGGCGGCTCCATTCTCTCTCGGTCTAATGACACAGACTCGACCGCCTTGTGGCTTTCTGCCTCT
GCTGGCATATGCCCAGCCAGTCCGTTGCTGGCTGAGACAACCACGTCTGCGACCGAGGCGGCTGCTCTGCTTGAG
AGCCTGGACAGTGAAGACCTGACCGATTATCTTTTGCGCATTTTCTTCGGCTCGTTCGGCATGCCGACGAAAATT
GGCCGACTTCACTACGGCTATCCCAACGTGTCTTCGGCAGATGGCGGCTTTCCCGCTTCTACGCCGTCTGCGTCG
CTCTTAGGCAACGTCGGCTTCCTACACAATCTCACTCGAAGCCCGACGGTAAATCGTACCGTCGTGACGGTTCTC
GAAGGACAGGTCATCACTGTTTTAGTCATCATCTGCTTCATTCTCGTCATCTTGGTGCGGGACTACGTGGTCCAG
CAGCAGCCCGAAATCAACATGCGTGCCGTATTCGAGGAGCCAGGGAACGAACTGCACCCTGATGGTCGCAACATG
GTCCAAGCCGTGGCCGTTGAACCAGCTCAACAAATCCAGAGGCCAGAGTCTGACGACGAGGCATCGGACAACGCC
GATCGGCAGCCCCTTGCATCAGTATCAGAGGCTGCTCCGGGAAACATTGGTGAGGGTAGTGGTATTTTCGATGCT
GAGAATACTGCACTCGCGAGCGCACATGCTGTCACTGCCAGCGGATCCGGTCTGGACTCGGTTCGGGACAAGATT
GACTCGGCCACGGTGACCAGTATCAGCCACCAAGGCAATAGCGTCAGCGAACCACTCCCAGCGCCTCGCCACGAC
ACCGACGATCTTGCTATTCAGCAAGGTTTGGAGCCTTTCCACGAGCCGGGTACATGGAATGACGCAGCTCTTAGC
CATGTCGAGAGATCAAGTCAGCAATCCGCCCCGTCAGGTTCTGAGGTGCAAAAGTTCTCTGAGGCTAGCGAAGAG
CCTTTTCAACACCGCAGTTCTACGGAAAGCGGCGCACCTGATGAAAAGGGAAAGTCGCGAGAGCTGGCGTCGCCG
AGACCCGCTATTGAACTCCAACCTGGGCCTTTGAGGAGGCGTGCCGCCTCGGATGGGCCAACGAGAAGACGCGCT
GCCTCGGATGGGCCTTACCATCAACCGGGAATGAATCCTCTGGGGAGCAACAATTGGTCTTTTTCACGCTTGCCG
GCCGACGGCGATTCAGCTCGACCACATGAAGCTATCGATGCACATGCGCATCAGAACGACGACTTGCCTACCAAC
TCTAACTCAGCCGATGAAGGATCGGTACTTAGCAGCACGGCCACGGCTCATACCCGCGATGATGATAATGGAGAG
CTTCTACCTGAACGAGGTCCTGCTCAAGAAGAGGATCCTCCAGCCGATGACACTGCTCTTGGGGATGGCTTAGAG
CCGGCAGGCTTGGTCGATCGTGTCGCTCATTTCATGTGGGGTGACCTCGAAGAACACCAAGAGGCAAACCAGGCA
AACCTCGCCGGCGAAGACGATGCCACCGACGACGATGGCGACGGCGATGGCGATGACGAAGACGAAGATCCTTGG
GTCGACGTGCCAATGGCCGAAGGCGTCGAAGAGAACGGTGATGTCGATATCGAGGACGTGGACGGCGCAGTGGAC
GGTGCAGGATTGGACGCCGAAGCACTAGACGATCTGGAGGATTTTGAGGGTGTCATGGAGCTCATCGGTATGCGC
GGTCCCATCGCCGGGCTGTTTCAAAACGCCATCTTTTGCGCCGTCCTGGTGTCCGTCACCATCTTTGCCTGCATC
TTCGTTCCCTACAACGTGGGCCGCATCGCCTTCTGGGTCGTGGCCAACCCCATGCAACTCGTTCGGATACTCTTC
GAGTTTTCCAAGGTGGTGCAGGACGCCGTAGTCATGCTGGGCGGGCTGAGCTCATGGTTTGTACTCAACCTGCTG
GACATGTTCACCGGCCTGCTCGGCGGGCCGCTGGCGACCAAGATTGTGACGGTGAGGAAAGCATCGTGGGGGCTC
TGGACCGGAGCGGGAACCAGAGTCATGGATTACGCCCTGCTGGAATTCCCCATTTCCGCCTCAGAGATGCACAAC
TTCTCTGCCATTAGTCACGAGGCCCTCAACACCGTCAAGGGCTCCGTCATGTCGGCCTTCCTAGTCGTCAGTGGT
TGGCTCGCTGCCTTGATGACACCGAGCTTCTATGCGATCGATGAGGGATCTTTAGCTGCAGCGGCAGCAGCTGTG
GGCACAACTGCGAGCAGGCTTAAGGCCGCTCTGTCGCTTGTTCTTGATCCGAGCTCTTGGGTCATTGATCTCAGC
AGGACGGAGGCGCGCACGCCCAATCCGGATCTGGCCTATTGGTCGGGGCTCGACCGCTCCTGGGCTATCCTCGCC
GGGTACCTCACAATCTTCGCCATGGGTGCCATGTATCTGCGGAGAGGAACGCCCTTCTCGAGACATAACATGGTG
CAGGCGTGGGAGGCGGGCGTCATCGATACCCTTCACCAGGCTAGCGGCATCATGAAGGTCATTGTCATCATCAGC
ATCGAAATGTTGGTGTTTCCGCTCTACTGTGGCCTTCTGCTCGACGCCGCCCTCCTGCCACTTTTTGAGAACACT
ACGATCAGATCACGGATCCTCTTCACTTACAATTTCCCCCTGACTTCCATATTCGTACACTGGTTTGTGGGCACC
GGATACATGTTCCATTTTGCTCTCTTTGTGTCCATGTGCCGCAAGATCATGCGACCAGGCGTTCTCTATTTTATC
CGAGATCCCGACGACCCCGAGTTTCATCCCATCCGCGACGTGTTGGAGCGAAGCCTGACGACGCAGCTACGGAAG
ATTCTCTTCTCTGCCTTTGTGTACGGCGCCCTCGTCATCGTCTGCCTTGGTGGTGTAGTATGGAGTCTTTCGTAC
ACCTTGCCGGGAGTGCTCCCAATACACTACTCGTCCAACGAGCCGGTTCTCGAATTCCCCATCGACCTTTTATTT
TACAACTTCCTCATGCCCCAAGCAGTCAAGGTTCTGAGGCCAGGTGATGGACTGCACGCCATGTACACGTGGTGG
TTCCGGAAGTGTGCTCGCGGCTTGCGACTCACCTTTTTCCTTTTTGGAGAACGGCGCGTCGATGAGGAGGGCACC
CTTCAGCTTGAGCTTGACGTGGCAAACAGCCTCCCACGCTACAAGAGGCTGTTCCTCGAGCTCAGCGAGGACAAC
ATGGTCGTACCCAAGACTTGGAGCGACACGTTTGAGGGAGGCGATGCGAAGCCTAACCCATCACTCTCGAGCCGG
GAGGAGAGACAACTGCGGCGAAAGAAACAGCATCTGGTAGCCTCCGGCCAGCTTGTGCGGAGTGGACGGTTCGTG
AGAGCACCGGCGTCTGACCGTGTCAACATTCCCAAGAGTGAGCCGGTCCTGCTACCCGTGACGGAGCTGGGCCGA
CGCAAGGATGGCAAGCCGGACAATGATGTTTACGCATCGAGCCAGTACCAGATGGTTTACATACCGCCAAACTTT
CGTCTCAGGATCTTCCTCTTCATCCTCTTCATCTGGCTGTTCGCGGCCATGACGGGGGTCGGCATCACGATCGCC
CCGCTGGCACTGGGGCGGAAGATGTTTAAGCTGCTGATTCCCGAGCACATCCGCACCAACGACATCTACGCCTTT
AGCATCGGTATCTATCTGCTTGGCACCGCGAGTTACTCTATCCTCTGCGTTCAGAAGATTACGACCGAGGTCCGG
GCCTGGGTGCGCAGAGTATGGGCCGAGGCGACAAGGGGACACGCTCTCGTGCATGCGTGGAACGGTCTTTGCAGC
GTTTCCCGGCTGCTGTATGCCTACGCGTGCATCCTGATATTGTTCCCGCTGTTGTCGTCGACGCTGATGGAACTC
TACATCACTATCCCGCTGCATACGTACATGGACCCACCAACGGCTGTATCAGCGCCGAAGCAGGCCGGCGAGGGA
GGCCGGCACACGATTCGTGTCATCCAGGCGTGGACGCTAGGGCTTCTGTACCTGAACCTGGGAACCAGGATGGTG
ACTTCACTGTTCCCGGAGAGTCGAGCGGCGCTGGCGGTGCGCATCATGATGCGGCGAGGATGGCTACGACCCGAC
GTTGGCATCCTCACGAGGGCGTTTGTGATGCCCGGACTGGCTCTGGCGGCGTTGGCAATGTTCGCTCCGCCGTTG
ACGGCCAGCCTGCTGATCAAGATGGAGCTACTGGGCAAGGGGTCCGACGGGTCTGGCGAATTGGCCGCCATCTAC
CGACACTCGTATCCTGCGGCGCTGTTGTGCGTCGTCGTGGTCAAGCACGCGGAGACGTGCGTGCGTGTGCGTGGC
CTCTGTTCACTGTGCTTATGGGAGTACCGTTTCGACTCGCTCTCTTGCAAACCTTGGAGCCTCGCCATGGCTGAG
CCACCCTCGTCGCCTCCGAGCGAGGCCACCAGCGCCGAGGATGCCCTCTTCTGGTACAAGTCGCAGTACGAGCTG
CTCGAGTCCGAACTTGCCGAATTTCGAGAATCGAGCCGCGAACTGGAGAAGGAGTTGGAAAAGGACATTGAGCGT
GCCGAAAAGCAGGAGAGAATGTTCCAGGAAAAGGCCGAGGCGCTGGGCTTCGAGGTGGAAGAGTGGAAGAGGAAA
CATAAGGAGGCCAAAACCGAGGCCGGCGCGGCCCAGGCGGCTCTCGAAAAAGAGATAACCACACTCAGAGACTCG
AACAGGTCGCTACAGCTGCGGCTGAGGGATATCGAGGTTGCAAACGATGACTTTGAGCGCCAGGCACGCAATACA
TCATCTTCGTTGGAAGACATGGAGTCCAAATACAACCAGGCCATTGAGCGCGGCGTCATGATGGAGGAGGAGATC
AAGGCGGGCGAGCAAGAGCGAGAGCAGCTGCGCATCGACTCGCAGCGACTTCGCGAAGAGCTGGCCGATCTCAAG
ATTGAGGCAGAGCTGATGCAAGATAAGATCAAGAAACACGAGGCGAGGCACTTGTCGGCCATCTCGACCGATCTC
TCCGCCCTGGGCTCGCCCACTTTTGACAAGCATCCAGAGGAGTCGCCGGACTCGTCCGCCAGTTCGCCGCTCGTC
ACGACGCCCACGGAGACGAACAAGGCCCTGTCCCGCGCCTCCGACGTGACCGACCCGCCGTCGCCGCCCATGTCG
GATGCTTCGGCACCCGTCCAGAGGGTAGCGGAGGCAACGGCCAGGACGAAGACGCCGGGGAGGGCCGTAGACGGG
CCACCTCGCAAGTCCCGTCTGCCTTCGCTCGAAGGCAACGCCACGCCCAAGATGCGGCCCCGTCCCTCTTTGGGC
ACGGCCACGGCTCCCGCGAGGGCCCCCGGAGGTAGGGTCTCTGGTGTCGGCGTCAATGTTCGGACACCGTCGGCT
CGACAGCCTAAGGGTCGTGTTGCCGCTTCGCACAAGATTCCCGCTTCCAACTCGCTGTCGCACATCCGGTCGCTC
ACGGCGCAAATGCAGCGGCTCGAAGCCCGAGTGCAATCGGCCCGATCCAAGTTACCGGCGCCGACGACCTCGTCG
TCTCCGAGAGCATCACCGAGAGGGTCCAGTCTCGGACATCACGTGCCGTCGACTGTGACGATCCGCAGCCGGAAG
CGGGCCGTAGCGTCATCGGCCTCGTCCATGGCGGGCGATGAGGAGGCGACACCGACCAACCCGCGCGCGACCAGG
AGTCACGTCCCGCGACTCAGCACGTCCGGTGTAGGCCGACTCTCGTTTGGGCCGGTGCCGAACCGAGGTCCCGAG
CCTGACATGAGCCGGCCGAGCTCGCGAGCCAGCCACTCGTCGCAAGCGAGGCCGGCGTCGAGGACGGACATGGTG
CGACCGCCGCGGCCCATTTCGCAGACTTCGGTGACACGGACGCCGCTGGGCAGGCCGCGGTCCTCACTGAGCGGG
TCCCTCCACAGCCGCTCGGGGAGCATCGGGCGCGCGGAAGAAGACGAGTTCCGGACACCAAGTCGGCGAGGAACG
TACTCGAAACTCGAGACGGAGTCGGGCATCCCGGGGCCGGGGAGTGGCATACCGACGCCAAGCTCCAGAAGGCAG
AGCGGCGGGAGGCATACGGGCCGGGAGTCTGCAGCGGGACGGCACAGGAAGCTTAGCGACCTGGGCGAGACATAT
TGA
Transcript >Ophcf2|06938
ATGGCCGACGCCACCTCCGATCACAAGCAGCCTGACCAAGCTTCTCACCTCAAGCATGGCCGATCTAGGGTTCCG
GCTCAGGCGCTCGACGCAGCGCCATCCATCTGTCGCATATGTCGCGGCGAAGGCACCGCAGCTGAGCCTCTCTTT
TACCCTTGCAAATGCAGCGGCAGCATCAAGTACGTCCATCAGGATTGTCTGATGGAGTGGTTGTCGCATTCCCAG
AAGAAATACTGCGAGCTTTGCAAGACTTCGTTCCGCTTCACCAAGCTCTATGCACCCGACATGCCAAAATCTCTC
CCCGTCCACGTTTTCGTCGAGCATCTGGGCAAGTATCTGTTGCGGAACCTTTTGACGTGGCTTCGAGCCGTCGTC
ACCATCAGCGTATGGGCATGCTGGCTGCCCTATTTCATGCGCTCTGTCTGGTCCTTTATGTTCTGGGTCAGCGAC
GAGGGCCTTGCCGGCGGCTCCATTCTCTCTCGGTCTAATGACACAGACTCGACCGCCTTGTGGCTTTCTGCCTCT
GCTGGCATATGCCCAGCCAGTCCGTTGCTGGCTGAGACAACCACGTCTGCGACCGAGGCGGCTGCTCTGCTTGAG
AGCCTGGACAGTGAAGACCTGACCGATTATCTTTTGCGCATTTTCTTCGGCTCGTTCGGCATGCCGACGAAAATT
GGCCGACTTCACTACGGCTATCCCAACGTGTCTTCGGCAGATGGCGGCTTTCCCGCTTCTACGCCGTCTGCGTCG
CTCTTAGGCAACGTCGGCTTCCTACACAATCTCACTCGAAGCCCGACGGTAAATCGTACCGTCGTGACGGTTCTC
GAAGGACAGGTCATCACTGTTTTAGTCATCATCTGCTTCATTCTCGTCATCTTGGTGCGGGACTACGTGGTCCAG
CAGCAGCCCGAAATCAACATGCGTGCCGTATTCGAGGAGCCAGGGAACGAACTGCACCCTGATGGTCGCAACATG
GTCCAAGCCGTGGCCGTTGAACCAGCTCAACAAATCCAGAGGCCAGAGTCTGACGACGAGGCATCGGACAACGCC
GATCGGCAGCCCCTTGCATCAGTATCAGAGGCTGCTCCGGGAAACATTGGTGAGGGTAGTGGTATTTTCGATGCT
GAGAATACTGCACTCGCGAGCGCACATGCTGTCACTGCCAGCGGATCCGGTCTGGACTCGGTTCGGGACAAGATT
GACTCGGCCACGGTGACCAGTATCAGCCACCAAGGCAATAGCGTCAGCGAACCACTCCCAGCGCCTCGCCACGAC
ACCGACGATCTTGCTATTCAGCAAGGTTTGGAGCCTTTCCACGAGCCGGGTACATGGAATGACGCAGCTCTTAGC
CATGTCGAGAGATCAAGTCAGCAATCCGCCCCGTCAGGTTCTGAGGTGCAAAAGTTCTCTGAGGCTAGCGAAGAG
CCTTTTCAACACCGCAGTTCTACGGAAAGCGGCGCACCTGATGAAAAGGGAAAGTCGCGAGAGCTGGCGTCGCCG
AGACCCGCTATTGAACTCCAACCTGGGCCTTTGAGGAGGCGTGCCGCCTCGGATGGGCCAACGAGAAGACGCGCT
GCCTCGGATGGGCCTTACCATCAACCGGGAATGAATCCTCTGGGGAGCAACAATTGGTCTTTTTCACGCTTGCCG
GCCGACGGCGATTCAGCTCGACCACATGAAGCTATCGATGCACATGCGCATCAGAACGACGACTTGCCTACCAAC
TCTAACTCAGCCGATGAAGGATCGGTACTTAGCAGCACGGCCACGGCTCATACCCGCGATGATGATAATGGAGAG
CTTCTACCTGAACGAGGTCCTGCTCAAGAAGAGGATCCTCCAGCCGATGACACTGCTCTTGGGGATGGCTTAGAG
CCGGCAGGCTTGGTCGATCGTGTCGCTCATTTCATGTGGGGTGACCTCGAAGAACACCAAGAGGCAAACCAGGCA
AACCTCGCCGGCGAAGACGATGCCACCGACGACGATGGCGACGGCGATGGCGATGACGAAGACGAAGATCCTTGG
GTCGACGTGCCAATGGCCGAAGGCGTCGAAGAGAACGGTGATGTCGATATCGAGGACGTGGACGGCGCAGTGGAC
GGTGCAGGATTGGACGCCGAAGCACTAGACGATCTGGAGGATTTTGAGGGTGTCATGGAGCTCATCGGTATGCGC
GGTCCCATCGCCGGGCTGTTTCAAAACGCCATCTTTTGCGCCGTCCTGGTGTCCGTCACCATCTTTGCCTGCATC
TTCGTTCCCTACAACGTGGGCCGCATCGCCTTCTGGGTCGTGGCCAACCCCATGCAACTCGTTCGGATACTCTTC
GAGTTTTCCAAGGTGGTGCAGGACGCCGTAGTCATGCTGGGCGGGCTGAGCTCATGGTTTGTACTCAACCTGCTG
GACATGTTCACCGGCCTGCTCGGCGGGCCGCTGGCGACCAAGATTGTGACGGTGAGGAAAGCATCGTGGGGGCTC
TGGACCGGAGCGGGAACCAGAGTCATGGATTACGCCCTGCTGGAATTCCCCATTTCCGCCTCAGAGATGCACAAC
TTCTCTGCCATTAGTCACGAGGCCCTCAACACCGTCAAGGGCTCCGTCATGTCGGCCTTCCTAGTCGTCAGTGGT
TGGCTCGCTGCCTTGATGACACCGAGCTTCTATGCGATCGATGAGGGATCTTTAGCTGCAGCGGCAGCAGCTGTG
GGCACAACTGCGAGCAGGCTTAAGGCCGCTCTGTCGCTTGTTCTTGATCCGAGCTCTTGGGTCATTGATCTCAGC
AGGACGGAGGCGCGCACGCCCAATCCGGATCTGGCCTATTGGTCGGGGCTCGACCGCTCCTGGGCTATCCTCGCC
GGGTACCTCACAATCTTCGCCATGGGTGCCATGTATCTGCGGAGAGGAACGCCCTTCTCGAGACATAACATGGTG
CAGGCGTGGGAGGCGGGCGTCATCGATACCCTTCACCAGGCTAGCGGCATCATGAAGGTCATTGTCATCATCAGC
ATCGAAATGTTGGTGTTTCCGCTCTACTGTGGCCTTCTGCTCGACGCCGCCCTCCTGCCACTTTTTGAGAACACT
ACGATCAGATCACGGATCCTCTTCACTTACAATTTCCCCCTGACTTCCATATTCGTACACTGGTTTGTGGGCACC
GGATACATGTTCCATTTTGCTCTCTTTGTGTCCATGTGCCGCAAGATCATGCGACCAGGCGTTCTCTATTTTATC
CGAGATCCCGACGACCCCGAGTTTCATCCCATCCGCGACGTGTTGGAGCGAAGCCTGACGACGCAGCTACGGAAG
ATTCTCTTCTCTGCCTTTGTGTACGGCGCCCTCGTCATCGTCTGCCTTGGTGGTGTAGTATGGAGTCTTTCGTAC
ACCTTGCCGGGAGTGCTCCCAATACACTACTCGTCCAACGAGCCGGTTCTCGAATTCCCCATCGACCTTTTATTT
TACAACTTCCTCATGCCCCAAGCAGTCAAGGTTCTGAGGCCAGGTGATGGACTGCACGCCATGTACACGTGGTGG
TTCCGGAAGTGTGCTCGCGGCTTGCGACTCACCTTTTTCCTTTTTGGAGAACGGCGCGTCGATGAGGAGGGCACC
CTTCAGCTTGAGCTTGACGTGGCAAACAGCCTCCCACGCTACAAGAGGCTGTTCCTCGAGCTCAGCGAGGACAAC
ATGGTCGTACCCAAGACTTGGAGCGACACGTTTGAGGGAGGCGATGCGAAGCCTAACCCATCACTCTCGAGCCGG
GAGGAGAGACAACTGCGGCGAAAGAAACAGCATCTGGTAGCCTCCGGCCAGCTTGTGCGGAGTGGACGGTTCGTG
AGAGCACCGGCGTCTGACCGTGTCAACATTCCCAAGAGTGAGCCGGTCCTGCTACCCGTGACGGAGCTGGGCCGA
CGCAAGGATGGCAAGCCGGACAATGATGTTTACGCATCGAGCCAGTACCAGATGGTTTACATACCGCCAAACTTT
CGTCTCAGGATCTTCCTCTTCATCCTCTTCATCTGGCTGTTCGCGGCCATGACGGGGGTCGGCATCACGATCGCC
CCGCTGGCACTGGGGCGGAAGATGTTTAAGCTGCTGATTCCCGAGCACATCCGCACCAACGACATCTACGCCTTT
AGCATCGGTATCTATCTGCTTGGCACCGCGAGTTACTCTATCCTCTGCGTTCAGAAGATTACGACCGAGGTCCGG
GCCTGGGTGCGCAGAGTATGGGCCGAGGCGACAAGGGGACACGCTCTCGTGCATGCGTGGAACGGTCTTTGCAGC
GTTTCCCGGCTGCTGTATGCCTACGCGTGCATCCTGATATTGTTCCCGCTGTTGTCGTCGACGCTGATGGAACTC
TACATCACTATCCCGCTGCATACGTACATGGACCCACCAACGGCTGTATCAGCGCCGAAGCAGGCCGGCGAGGGA
GGCCGGCACACGATTCGTGTCATCCAGGCGTGGACGCTAGGGCTTCTGTACCTGAACCTGGGAACCAGGATGGTG
ACTTCACTGTTCCCGGAGAGTCGAGCGGCGCTGGCGGTGCGCATCATGATGCGGCGAGGATGGCTACGACCCGAC
GTTGGCATCCTCACGAGGGCGTTTGTGATGCCCGGACTGGCTCTGGCGGCGTTGGCAATGTTCGCTCCGCCGTTG
ACGGCCAGCCTGCTGATCAAGATGGAGCTACTGGGCAAGGGGTCCGACGGGTCTGGCGAATTGGCCGCCATCTAC
CGACACTCGTATCCTGCGGCGCTGTTGTGCGTCGTCGTGGTCAAGCACGCGGAGACGTGCGTGCGTGTGCGTGGC
CTCTGTTCACTGTGCTTATGGGAGTACCGTTTCGACTCGCTCTCTTGCAAACCTTGGAGCCTCGCCATGGCTGAG
CCACCCTCGTCGCCTCCGAGCGAGGCCACCAGCGCCGAGGATGCCCTCTTCTGGTACAAGTCGCAGTACGAGCTG
CTCGAGTCCGAACTTGCCGAATTTCGAGAATCGAGCCGCGAACTGGAGAAGGAGTTGGAAAAGGACATTGAGCGT
GCCGAAAAGCAGGAGAGAATGTTCCAGGAAAAGGCCGAGGCGCTGGGCTTCGAGGTGGAAGAGTGGAAGAGGAAA
CATAAGGAGGCCAAAACCGAGGCCGGCGCGGCCCAGGCGGCTCTCGAAAAAGAGATAACCACACTCAGAGACTCG
AACAGGTCGCTACAGCTGCGGCTGAGGGATATCGAGGTTGCAAACGATGACTTTGAGCGCCAGGCACGCAATACA
TCATCTTCGTTGGAAGACATGGAGTCCAAATACAACCAGGCCATTGAGCGCGGCGTCATGATGGAGGAGGAGATC
AAGGCGGGCGAGCAAGAGCGAGAGCAGCTGCGCATCGACTCGCAGCGACTTCGCGAAGAGCTGGCCGATCTCAAG
ATTGAGGCAGAGCTGATGCAAGATAAGATCAAGAAACACGAGGCGAGGCACTTGTCGGCCATCTCGACCGATCTC
TCCGCCCTGGGCTCGCCCACTTTTGACAAGCATCCAGAGGAGTCGCCGGACTCGTCCGCCAGTTCGCCGCTCGTC
ACGACGCCCACGGAGACGAACAAGGCCCTGTCCCGCGCCTCCGACGTGACCGACCCGCCGTCGCCGCCCATGTCG
GATGCTTCGGCACCCGTCCAGAGGGTAGCGGAGGCAACGGCCAGGACGAAGACGCCGGGGAGGGCCGTAGACGGG
CCACCTCGCAAGTCCCGTCTGCCTTCGCTCGAAGGCAACGCCACGCCCAAGATGCGGCCCCGTCCCTCTTTGGGC
ACGGCCACGGCTCCCGCGAGGGCCCCCGGAGGTAGGGTCTCTGGTGTCGGCGTCAATGTTCGGACACCGTCGGCT
CGACAGCCTAAGGGTCGTGTTGCCGCTTCGCACAAGATTCCCGCTTCCAACTCGCTGTCGCACATCCGGTCGCTC
ACGGCGCAAATGCAGCGGCTCGAAGCCCGAGTGCAATCGGCCCGATCCAAGTTACCGGCGCCGACGACCTCGTCG
TCTCCGAGAGCATCACCGAGAGGGTCCAGTCTCGGACATCACGTGCCGTCGACTGTGACGATCCGCAGCCGGAAG
CGGGCCGTAGCGTCATCGGCCTCGTCCATGGCGGGCGATGAGGAGGCGACACCGACCAACCCGCGCGCGACCAGG
AGTCACGTCCCGCGACTCAGCACGTCCGGTGTAGGCCGACTCTCGTTTGGGCCGGTGCCGAACCGAGGTCCCGAG
CCTGACATGAGCCGGCCGAGCTCGCGAGCCAGCCACTCGTCGCAAGCGAGGCCGGCGTCGAGGACGGACATGGTG
CGACCGCCGCGGCCCATTTCGCAGACTTCGGTGACACGGACGCCGCTGGGCAGGCCGCGGTCCTCACTGAGCGGG
TCCCTCCACAGCCGCTCGGGGAGCATCGGGCGCGCGGAAGAAGACGAGTTCCGGACACCAAGTCGGCGAGGAACG
TACTCGAAACTCGAGACGGAGTCGGGCATCCCGGGGCCGGGGAGTGGCATACCGACGCCAAGCTCCAGAAGGCAG
AGCGGCGGGAGGCATACGGGCCGGGAGTCTGCAGCGGGACGGCACAGGAAGCTTAGCGACCTGGGCGAGACATAT
TGA
Gene >Ophcf2|06938
ATGGCCGACGCCACCTCCGATCACAAGCAGCCTGACCAAGCTTCTCACCTCAAGCATGGCCGATCTAGGGTTCCG
GCTCAGGCGCTCGACGCAGCGCCATCCATCTGTCGCATATGTCGCGGCGAAGGCACCGCAGCTGAGCCTCTCTTT
TACCCTTGCAAATGCAGCGGCAGCATCAAGTACGTCCATCAGGATTGTCTGATGGAGTGGTTGTCGCATTCCCAG
AAGAAATACTGCGAGCTTTGCAAGACTTCGTTCCGCTTCACCAAGCTCTATGCACCCGACATGCCAAAATCTCTC
CCCGTCCACGTTTTCGTCGAGCATCTGGGCAAGTATCTGTTGCGGAACCTTTTGACGTGGCTTCGAGCCGTCGTC
ACCATCAGCGTATGGGCATGCTGGCTGCCCTATTTCATGCGCTCTGTCTGGTCCTTTATGTTCTGGGTCAGCGAC
GAGGGCCTTGCCGGCGGCTCCATTCTCTCTCGGTCTAATGACACAGACTCGACCGCCTTGTGGCTTTCTGCCTCT
GCTGGCATATGCCCAGCCAGTCCGTTGCTGGCTGAGACAACCACGTCTGCGACCGAGGCGGCTGCTCTGCTTGAG
AGCCTGGACAGTGAAGACCTGACCGATTATCTTTTGCGCATTTTCTTCGGCTCGTTCGGCATGCCGACGAAAATT
GGCCGACTTCACTACGGCTATCCCAACGTGTCTTCGGCAGATGGCGGCTTTCCCGCTTCTACGCCGTCTGCGTCG
CTCTTAGGCAACGTCGGCTTCCTACACAATCTCACTCGAAGCCCGACGGTAAATCGTACCGTCGTGACGGTTCTC
GAAGGACAGGTCATCACTGTTTTAGTCATCATCTGCTTCATTCTCGTCATCTTGGTGCGGGACTACGTGGTCCAG
CAGCAGCCCGAAATCAACATGCGTGCCGTATTCGAGGAGCCAGGGAACGAACTGCACCCTGATGGTCGCAACATG
GTCCAAGCCGTGGCCGTTGAACCAGCTCAACAAATCCAGAGGCCAGAGTCTGACGACGAGGCATCGGACAACGCC
GATCGGCAGCCCCTTGCATCAGTATCAGAGGCTGCTCCGGGAAACATTGGTGAGGGTAGTGGTATTTTCGATGCT
GAGAATACTGCACTCGCGAGCGCACATGCTGTCACTGCCAGCGGATCCGGTCTGGACTCGGTTCGGGACAAGATT
GACTCGGCCACGGTGACCAGTATCAGCCACCAAGGCAATAGCGTCAGCGAACCACTCCCAGCGCCTCGCCACGAC
ACCGACGATCTTGCTATTCAGCAAGGTTTGGAGCCTTTCCACGAGCCGGGTACATGGAATGACGCAGCTCTTAGC
CATGTCGAGAGATCAAGTCAGCAATCCGCCCCGTCAGGTTCTGAGGTGCAAAAGTTCTCTGAGGCTAGCGAAGAG
CCTTTTCAACACCGCAGTTCTACGGAAAGCGGCGCACCTGATGAAAAGGGAAAGTCGCGAGAGCTGGCGTCGCCG
AGACCCGCTATTGAACTCCAACCTGGGCCTTTGAGGAGGCGTGCCGCCTCGGATGGGCCAACGAGAAGACGCGCT
GCCTCGGATGGGCCTTACCATCAACCGGGAATGAATCCTCTGGGGAGCAACAATTGGTCTTTTTCACGCTTGCCG
GCCGACGGCGATTCAGCTCGACCACATGAAGCTATCGATGCACATGCGCATCAGAACGACGACTTGCCTACCAAC
TCTAACTCAGCCGATGAAGGATCGGTACTTAGCAGCACGGCCACGGCTCATACCCGCGATGATGATAATGGAGAG
CTTCTACCTGAACGAGGTCCTGCTCAAGAAGAGGATCCTCCAGCCGATGACACTGCTCTTGGGGATGGCTTAGAG
CCGGCAGGCTTGGTCGATCGTGTCGCTCATTTCATGTGGGGTGACCTCGAAGAACACCAAGAGGCAAACCAGGCA
AACCTCGCCGGCGAAGACGATGCCACCGACGACGATGGCGACGGCGATGGCGATGACGAAGACGAAGATCCTTGG
GTCGACGTGCCAATGGCCGAAGGCGTCGAAGAGAACGGTGATGTCGATATCGAGGACGTGGACGGCGCAGTGGAC
GGTGCAGGATTGGACGCCGAAGCACTAGACGATCTGGAGGATTTTGAGGGTGTCATGGAGCTCATCGGTATGCGC
GGTCCCATCGCCGGGCTGTTTCAAAACGCCATCTTTTGCGCCGTCCTGGTGTCCGTCACCATCTTTGCCTGCATC
TTCGTTCCCTACAACGTGGGCCGCATCGCCTTCTGGGTCGTGGCCAACCCCATGCAACTCGTTCGGATACTCTTC
GAGTTTTCCAAGGTGGTGCAGGACGCCGTAGTCATGCTGGGCGGGCTGAGCTCATGGTTTGTACTCAACCTGCTG
GACATGTTCACCGGCCTGCTCGGCGGGCCGCTGGCGACCAAGATTGTGACGGTGAGGAAAGCATCGTGGGGGCTC
TGGACCGGAGCGGGAACCAGAGTCATGGATTACGCCCTGCTGGAATTCCCCATTTCCGCCTCAGAGATGCACAAC
TTCTCTGCCATTAGTCACGAGGCCCTCAACACCGTCAAGGGCTCCGTCATGTCGGCCTTCCTAGTCGTCAGTGGT
TGGCTCGCTGCCTTGATGACACCGAGCTTCTATGCGATCGATGAGGGATCTTTAGCTGCAGCGGCAGCAGCTGTG
GGCACAACTGCGAGCAGGCTTAAGGCCGCTCTGTCGCTTGTTCTTGATCCGAGCTCTTGGGTCATTGATCTCAGC
AGGACGGAGGCGCGCACGCCCAATCCGGATCTGGCCTATTGGTCGGGGCTCGACCGCTCCTGGGCTATCCTCGCC
GGGTACCTCACAATCTTCGCCATGGGTGCCATGTATCTGCGGAGAGGAACGCCCTTCTCGAGACATAACATGGTG
CAGGCGTGGGAGGCGGGCGTCATCGATACCCTTCACCAGGCTAGCGGCATCATGAAGGTCATTGTCATCATCAGC
ATCGAAATGTTGGTGTTTCCGCTCTACTGTGGCCTTCTGCTCGACGCCGCCCTCCTGCCACTTTTTGAGAACACT
ACGATCAGATCACGGATCCTCTTCACTTACAATTTCCCCCTGACTTCCATATTCGTACACTGGTTTGTGGGCACC
GGATACATGTTCCATTTTGCTCTCTTTGTGTCCATGTGCCGCAAGATCATGCGACCAGGCGTTCTCTGTGAGGGC
TTGGTCTCCGTGCAAATCTTACTGCAGCCCTTAGCTGACTTGGAATCAGATTTTATCCGAGATCCCGACGACCCC
GAGTTTCATCCCATCCGCGACGTGTTGGAGCGAAGCCTGACGACGCAGCTACGGAAGATTCTCTTCTCTGCCTTT
GTGTACGGCGCCCTCGTCATCGTCTGCCTTGGTGGTGTAGTATGGAGTCTTTCGTACACCTTGCCGGGAGTGCTC
CCAATACACTACTCGTCCAACGAGCCGGTTCTCGAATTCCCCATCGACCTTTTATTTTACAACTTCCTCATGCCC
CAAGCAGTCAAGGTTCTGAGGCCAGGTGATGGACTGCACGCCATGTACACGTGGTGGTTCCGGAAGTGTGCTCGC
GGCTTGCGACTCACCTTTTTCCTTTTTGGAGAACGGCGCGTCGATGAGGAGGGCACCCTTCAGCTTGAGCTTGAC
GTGGCAAACAGCCTCCCACGCTACAAGAGGCTGTTCCTCGAGCTCAGCGAGGACAACATGGTCGTACCCAAGACT
TGGAGCGACACGTTTGAGGGAGGCGATGCGAAGCCTAACCCATCACTCTCGAGCCGGGAGGAGAGACAACTGCGG
CGAAAGAAACAGCATCTGGTAGCCTCCGGCCAGCTTGTGCGGAGTGGACGGTTCGTGAGAGCACCGGCGTCTGAC
CGTGTCAACATTCCCAAGAGTGAGCCGGTCCTGCTACCCGTGACGGAGCTGGGCCGACGCAAGGATGGCAAGCCG
GACAATGATGTTTACGCATCGAGCCAGTACCAGATGGTTTACATACCGCCAAACTTTCGTCTCAGGATCTTCCTC
TTCATCCTCTTCATCTGGCTGTTCGCGGCCATGACGGGGGTCGGCATCACGATCGCCCCGCTGGCACTGGGGCGG
AAGATGTTTAAGCTGCTGATTCCCGAGCACATCCGCACCAACGACATCTACGCCTTTAGCATCGGTATCTATCTG
CTTGGCACCGCGAGTTACTCTATCCTCTGCGTTCAGAAGATTACGACCGAGGTCCGGGCCTGGGTGCGCAGAGTA
TGGGCCGAGGCGACAAGGGGACACGCTCTCGTGCATGCGTGGAACGGTCTTTGCAGCGTTTCCCGGCTGCTGTAT
GCCTACGCGTGCATCCTGATATTGTTCCCGCTGTTGTCGTCGACGCTGATGGAACTCTACATCACTATCCCGCTG
CATACGTACATGGACCCACCAACGGCTGTATCAGCGCCGAAGCAGGCCGGCGAGGGAGGCCGGCACACGATTCGT
GTCATCCAGGCGTGGACGCTAGGGCTTCTGTACCTGAACCTGGGAACCAGGATGGTGACTTCACTGTTCCCGGAG
AGTCGAGCGGCGCTGGCGGTGCGCATCATGATGCGGCGAGGATGGCTACGACCCGACGTTGGCATCCTCACGAGG
GCGTTTGTGATGCCCGGACTGGCTCTGGCGGCGTTGGCAATGTTCGCTCCGCCGTTGACGGCCAGCCTGCTGATC
AAGATGGAGCTACTGGGCAAGGGGTCCGACGGGTCTGGCGAATTGGCCGCCATCTACCGACACTCGTATCCTGCG
GCGCTGTTGTGCGTCGTCGTGGTCAAGCACGCGGTCGGCATGGCCAGAGTCTTCAGGGGTTGGAGAGCTGGGATT
CGCGACGAGGCCTACCTCATCGGAGAGCGGCTACACAACTTTGGCATGACGGCGGCGGGAGGCGGCAGAGCCAAG
CGGGCATGGGGGGGCGGGAGGTCGAGGCTCTGAGTGGCTGGCTAGAGGGCAACGCGTAAATGTTGATTAGTAGCA
CGGTTGGAGCGATTGCGACGGCATGACGATTATAGACGGGATATCCGCCCAGTAATGGACTTGTCACGGGCCTCG
GCACCTGGTTGTAGGTGGTGTGGCGATGATGATGACGATTTGTCCCTTCCTGGCTTTGTCTGTACAGTTCTTCCA
TGCCGTCATGTGACGGCAACGGTTGACGGCTGGAACGTTAGGTGAGACTTTGTCTCGTGGAACGCTCTATACATA
CATACATACGTACACGTCAAGGTCCGCCGTCAGGGATTGCGCAGAGACCGAATGATCTGATGGCTCGAGGGCTCT
GCGAGGTAGGATGAGAGAGGGAGAAAGAGACCTAGATAGGTAGGGAGGCGCGTGTATGTAAAAGGAGACATGGAC
TGAAGAGGAGAGGTAGGTGGGCTGGGCTTTTCCCCTGTCGAACTGAAACACGTGACGACGCGCGGCCCAAAGCGG
ATGAGTGCCCCGCCTGTCGTTGCCCTTGACGCCAGGCGCTAAGCCCAACGCGGACGCGCTGTTGCTACCAGGGGC
CTGAGGAGGGGGCCTGAGTTCTGCATCAACAGTTTCGGCAACACACGACAAGAAGCAGCCTCGACAACAGGCCGG
ACCGTTTGCGACGGGCAGGATATCGCAGGTAAGTTTGGGAGGAGAATCAGGCGGCGACGAAATCGACAGCGACTC
TCAAGTAGCGCCTCGTCCGACCCTTCACTGGCTCTCCCTCGGTCACGAGGGGGGCAAAGCGTCGTTTGCACCTCA
GACATTGTCAGGAGACGTGCGTGCGTGTGCGTGGGTGGGTTTTCGCAGTCACGACAACTACCTCTTCGTTTGGTC
CGGACTCGTCTGACGATACAGGCCACACAAGCCTCTGTTCACTGTGCTTATGGGAGTACCGTTTCGACTCGCTCT
CTTGCAAACCTTGGAGCCTCGCCATGGCTGAGCCACCCTCGTCGCCTCCGAGCGAGGCCACCAGCGCCGAGGATG
CCCTCTTCTGGTACAAGTCGCAGTACGAGCTGCTCGAGTCCGAACTTGCCGAATTTCGAGAATCGAGCCGCGAAC
TGGAGAAGGAGTTGGAAAAGGACATTGAGCGTGCCGAAAAGCAGGAGAGAATGTTCCAGGAAAAGGCCGAGGCGC
TGGGCTTCGAGGTGGAAGAGTGGAAGGTACTCCTACTCGTCACCTTCGTTACACTTGGCCACTGACTGAACGTCT
CGTGCAGAGGAAACATAAGGAGGCCAAAACCGAGGCCGGCGCGGCCCAGGCGGCTCTCGAAAAAGAGATAACCAC
ACTCAGAGACTCGAACAGGTCGCTACAGCTGCGGCTGAGGGATATCGAGGTTGCAAACGATGACTTTGAGCGCCA
GGCACGCAATACATCATCTTCGTTGGAAGACATGGAGTCCAAATACAACCAGGCCATTGAGCGCGGCGTCATGAT
GGAGGAGGAGATCAAGGCGGGCGAGCAAGAGCGAGAGCAGCTGCGCATCGACTCGCAGCGACTTCGCGAAGAGCT
GGCCGATCTCAAGATTGAGGCAGAGCTGATGCAAGATAAGATCAAGAAACACGAGGCGAGGCACTTGTCGGCCAT
CTCGACCGATCTCTCCGCCCTGGGCTCGCCCACTTTTGACAAGCATCCAGAGGAGTCGCCGGACTCGTCCGCCAG
TTCGCCGCTCGTCACGACGCCCACGGAGACGAACAAGGCCCTGTCCCGCGCCTCCGACGTGACCGACCCGCCGTC
GCCGCCCATGTCGGATGCTTCGGCACCCGTCCAGAGGGTAGCGGAGGCAACGGCCAGGACGAAGACGCCGGGGAG
GGCCGTAGACGGGCCACCTCGCAAGTCCCGTCTGCCTTCGCTCGAAGGCAACGCCACGCCCAAGATGCGGCCCCG
TCCCTCTTTGGGCACGGCCACGGCTCCCGCGAGGGCCCCCGGAGGTAGGGTCTCTGGTGTCGGCGTCAATGTTCG
GACACCGTCGGCTCGACAGCCTAAGGGTCGTGTTGCCGCTTCGCACAAGATTCCCGCTTCCAACTCGCTGTCGCA
CATCCGGTCGCTCACGGCGCAAATGCAGCGGCTCGAAGCCCGAGTGCAATCGGCCCGATCCAAGTTACCGGCGCC
GACGACCTCGTCGTCTCCGAGAGCATCACCGAGAGGGTCCAGTCTCGGACATCACGTGCCGTCGACTGTGACGAT
CCGCAGCCGGAAGCGGGCCGTAGCGTCATCGGCCTCGTCCATGGCGGGCGATGAGGAGGCGACACCGACCAACCC
GCGCGCGACCAGGAGTCACGTCCCGCGACTCAGCACGTCCGGTGTAGGCCGACTCTCGTTTGGGCCGGTGCCGAA
CCGAGGTCCCGAGCCTGACATGAGCCGGCCGAGCTCGCGAGCCAGCCACTCGTCGCAAGCGAGGCCGGCGTCGAG
GACGGACATGGTGCGACCGCCGCGGCCCATTTCGCAGACTTCGGTGACACGGACGCCGCTGGGCAGGCCGCGGTC
CTCACTGAGCGGGTCCCTCCACAGCCGCTCGGGGAGCATCGGGCGCGCGGAAGAAGACGAGTTCCGGACACCAAG
TCGGCGAGGAACGTACTCGAAACTCGAGACGGAGTCGGGCATCCCGGGGCCGGGGAGTGGCATACCGACGCCAAG
CTCCAGAAGGCAGAGCGGCGGGAGGCATACGGGCCGGGAGTCTGCAGCGGGACGGCACAGGAAGCTTAGCGACCT
GGGCGAGACATATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail