Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06937
Gene name
Locationscaffold_09:30631..34130
Strand-
Gene length (bp)3499
Transcript length (bp)3288
Coding sequence length (bp)3288
Protein length (aa) 1096

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.5

Transmembrane Domains

Domain # Start End Length
1 37 59 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 80.50 42.25 118.76
Alive In ants, during behavior modification 37.76 20.60 54.92
Dead In ants, recently dead 52.02 28.89 75.16

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.057273 no
Dead Fungus 0.027782 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06937
MLDSTSAWLVDGSRTANGKLNGKPRSWTRKAKIRRGFFSRALSLVARLTIWSIILTVLFRCPSSLEACDETSPLI
CSHYFRAKATVAPRLQPYYERYASSYVHVVKPYYQAVDSHILTPTRVYAVRYGAPWVNKARARAWSQWEVNGQPR
LTQLQDLTAARYDQSIAPHVARAGRAVKPYYRIARANLLQLYYKYAMPGYEFIHPHAARSYAVARNFTSNKALPA
TFWIWNKGNLFLETAVWPQLRLLYKENVEPQLVRIGERLGRYKNKAQSKVLQQSGSPKTAASSSEPTQSHTTPSS
STVSESVAPDFDVDGPDFEGSSPKYLHPVKAPTPRENENEMGRNVREMVTHDLETWQEKFMSQAEEKAHEIEDRV
DAIAQRSIEMHLFTTGRQLLGQLNSTAESEVDQLKRTIVSIVKENPANAQESAIAAVRSAGIAIKNSAQAIREWR
ENFDAQLKTTVNNDVEEYFDILDETRSLALQKIGMKWAWTNGISYHDWAKYHELKNALGQLTNELRELVVTHPGL
IEAQDASAMVETQAMTIAAGAAQELSRLKEVARWKLLARDTTDSFDFESMKSAAEAAQTHSDGLSDQSEEPNDAL
VGISPVIGIFDSADGATSKPEELVSEQAELSSSDTKATSAASMSHGRADDVETDITDSSGESRQAGRDGFDDEKV
KSKVAFGAAAQEVPDRRPILDEVGDSDLYADATSAAQAAYSSAFSAASERYSSALSVVSAQVYGTPKPVHEQLMA
SVSAAYGSAVAAASQRLDGAVSAASRGAYGTPTPTSGLGSLNWEKVESMAAQRLNEGRLWAEVQYQSALMALGVA
TPTPSADNAVEKAKFRYYAGLGIAQDRYTSFLAAASLAWSSVTATPTPTDLRGSASWAASAASASASSVAQAAGS
AAQAAGSAAQSAYSAATESVASVARAADDSLSSVADAASEQVSIAAVAIAGTWEKVLLELSAQIYAEPTAIGWGD
RLLDGASSCASAATETATEKAAAVTDAARSAADAASAQAARQFDAVHGIVSELVSGREPAYSESVLSRLSAAYAT
ASANVGSLASQASASAASVGERLGVAASHATEAVKESVQQGKDEL*
Coding >Ophcf2|06937
ATGCTCGACTCTACGAGCGCCTGGCTCGTCGATGGCAGTCGCACCGCCAACGGCAAACTGAACGGAAAGCCCAGG
AGCTGGACCAGGAAGGCCAAGATACGCCGTGGCTTCTTCTCCCGGGCTCTCAGCCTCGTTGCCAGGTTGACCATC
TGGTCGATTATTCTGACTGTGCTATTCCGCTGTCCCTCTTCCCTCGAAGCGTGCGACGAGACGTCACCCCTCATC
TGCAGTCACTACTTCCGAGCCAAGGCTACAGTCGCTCCTCGTCTCCAACCGTACTATGAACGCTATGCATCGTCA
TATGTACATGTCGTCAAGCCTTACTACCAAGCCGTTGACAGCCACATCCTGACGCCAACTCGCGTGTATGCCGTG
CGTTATGGGGCTCCTTGGGTTAACAAGGCCCGCGCCCGTGCCTGGTCTCAGTGGGAAGTCAACGGCCAGCCCCGG
CTGACACAGCTGCAAGACTTGACGGCGGCCCGTTACGATCAATCCATCGCGCCTCATGTCGCTCGGGCGGGTCGC
GCCGTCAAGCCATATTATCGGATCGCCCGAGCCAACCTGCTGCAGCTCTATTACAAGTACGCCATGCCCGGCTAC
GAATTTATTCATCCACACGCGGCACGAAGCTACGCCGTCGCTCGCAACTTCACATCCAACAAGGCTCTGCCGGCA
ACGTTTTGGATTTGGAATAAGGGAAATTTGTTTCTCGAGACAGCCGTCTGGCCGCAACTGCGATTGCTTTACAAG
GAAAATGTCGAGCCCCAGCTGGTGCGCATTGGAGAACGCCTCGGGCGGTACAAAAACAAGGCTCAATCCAAAGTA
CTGCAGCAAAGCGGGTCCCCCAAGACGGCTGCGTCGTCTAGCGAGCCTACACAATCACACACGACGCCGAGCTCC
TCTACAGTCTCCGAGAGCGTCGCGCCCGATTTTGACGTCGATGGCCCGGACTTTGAAGGCTCTAGCCCCAAATAC
CTCCATCCAGTGAAGGCTCCCACGCCCAGAGAAAACGAGAACGAGATGGGCCGGAACGTTCGCGAAATGGTCACG
CATGACCTAGAAACTTGGCAGGAGAAGTTCATGAGCCAGGCCGAAGAGAAGGCACACGAAATTGAAGACCGTGTC
GACGCGATTGCTCAGCGCAGCATTGAAATGCATCTCTTCACAACGGGGAGACAGCTTCTGGGGCAACTCAACTCG
ACAGCCGAGTCCGAAGTGGACCAACTGAAGCGGACGATTGTCTCCATCGTCAAGGAGAACCCTGCGAATGCACAG
GAAAGTGCCATTGCAGCCGTTCGATCGGCAGGCATCGCTATCAAGAACAGCGCTCAGGCGATTCGCGAATGGCGG
GAGAATTTCGACGCTCAACTCAAGACAACTGTCAATAACGACGTCGAGGAGTACTTTGATATCCTTGACGAGACC
AGGAGCCTTGCCTTGCAGAAGATTGGCATGAAATGGGCCTGGACCAACGGAATCTCATACCACGACTGGGCCAAA
TATCACGAGCTCAAAAATGCACTTGGGCAGTTGACGAATGAACTGAGAGAACTAGTTGTCACTCATCCCGGTTTG
ATCGAGGCTCAAGATGCCTCAGCAATGGTCGAGACGCAGGCCATGACGATTGCCGCCGGCGCCGCCCAGGAACTC
TCCCGCTTGAAGGAGGTTGCCCGCTGGAAGCTTTTGGCCCGCGATACGACCGATAGCTTCGATTTCGAGTCGATG
AAGTCGGCGGCCGAGGCTGCACAGACGCATTCAGATGGCTTATCAGATCAATCTGAAGAGCCAAACGATGCTCTT
GTCGGCATCTCGCCAGTCATTGGAATTTTCGACTCCGCCGATGGAGCGACGTCGAAGCCTGAGGAATTAGTCTCG
GAACAGGCCGAGTTGAGCAGCAGCGATACAAAAGCAACCTCGGCCGCGAGCATGTCTCATGGAAGAGCAGATGAT
GTCGAGACGGATATTACCGACTCATCGGGAGAAAGCCGGCAGGCCGGGCGTGACGGCTTCGACGACGAGAAGGTG
AAGTCAAAAGTGGCGTTCGGCGCCGCCGCTCAGGAGGTTCCCGACCGCCGTCCGATCTTGGACGAGGTCGGTGAC
TCCGACCTTTATGCCGATGCTACGTCCGCCGCCCAAGCTGCGTACTCGAGCGCCTTTTCTGCAGCGTCGGAACGG
TATAGTAGCGCGTTGTCTGTCGTTTCCGCACAGGTTTATGGCACGCCAAAGCCCGTTCATGAGCAGCTCATGGCT
TCCGTCTCGGCCGCCTACGGCAGCGCCGTCGCGGCGGCCAGCCAGAGGCTTGACGGGGCCGTCAGCGCCGCCTCA
CGCGGGGCATACGGGACGCCGACGCCGACCAGCGGGCTCGGCTCCCTAAACTGGGAAAAGGTCGAGTCAATGGCG
GCCCAGCGGCTCAATGAGGGCCGGCTCTGGGCCGAGGTGCAGTATCAAAGCGCTCTGATGGCTCTCGGAGTCGCG
ACACCGACGCCATCGGCCGACAACGCGGTTGAAAAGGCCAAGTTTCGCTACTACGCCGGCCTCGGCATCGCGCAG
GACCGGTACACGAGCTTCCTTGCCGCTGCTTCGTTGGCCTGGTCGTCGGTCACGGCGACGCCGACACCCACCGAC
CTACGGGGATCGGCCTCGTGGGCGGCGTCTGCGGCGAGCGCATCAGCCTCGTCTGTCGCGCAAGCTGCGGGCTCG
GCGGCACAGGCGGCCGGGTCTGCTGCTCAGTCTGCCTATTCGGCCGCGACCGAGAGCGTCGCCTCTGTGGCGCGT
GCTGCTGACGACTCCCTGTCGTCTGTCGCGGACGCCGCGAGCGAGCAGGTGTCCATTGCAGCAGTCGCCATCGCC
GGCACCTGGGAGAAGGTGCTGTTGGAGCTGAGCGCCCAGATATACGCCGAGCCGACAGCCATTGGATGGGGCGAT
CGACTGCTGGACGGCGCCAGCTCTTGCGCGTCTGCCGCGACCGAGACTGCCACGGAGAAGGCAGCGGCAGTCACC
GACGCGGCACGAAGCGCTGCCGATGCGGCCTCGGCGCAAGCCGCCCGGCAATTTGACGCCGTTCACGGCATCGTG
TCGGAGCTCGTGAGCGGCAGAGAACCGGCGTACAGCGAGAGCGTGCTCTCCCGACTGAGCGCCGCCTATGCTACA
GCCTCCGCCAACGTCGGCAGCCTTGCGAGCCAGGCCAGTGCCTCGGCGGCGTCGGTGGGAGAGAGACTCGGGGTC
GCGGCCAGTCATGCCACTGAGGCCGTCAAGGAGTCGGTTCAGCAGGGGAAGGATGAATTGTAG
Transcript >Ophcf2|06937
ATGCTCGACTCTACGAGCGCCTGGCTCGTCGATGGCAGTCGCACCGCCAACGGCAAACTGAACGGAAAGCCCAGG
AGCTGGACCAGGAAGGCCAAGATACGCCGTGGCTTCTTCTCCCGGGCTCTCAGCCTCGTTGCCAGGTTGACCATC
TGGTCGATTATTCTGACTGTGCTATTCCGCTGTCCCTCTTCCCTCGAAGCGTGCGACGAGACGTCACCCCTCATC
TGCAGTCACTACTTCCGAGCCAAGGCTACAGTCGCTCCTCGTCTCCAACCGTACTATGAACGCTATGCATCGTCA
TATGTACATGTCGTCAAGCCTTACTACCAAGCCGTTGACAGCCACATCCTGACGCCAACTCGCGTGTATGCCGTG
CGTTATGGGGCTCCTTGGGTTAACAAGGCCCGCGCCCGTGCCTGGTCTCAGTGGGAAGTCAACGGCCAGCCCCGG
CTGACACAGCTGCAAGACTTGACGGCGGCCCGTTACGATCAATCCATCGCGCCTCATGTCGCTCGGGCGGGTCGC
GCCGTCAAGCCATATTATCGGATCGCCCGAGCCAACCTGCTGCAGCTCTATTACAAGTACGCCATGCCCGGCTAC
GAATTTATTCATCCACACGCGGCACGAAGCTACGCCGTCGCTCGCAACTTCACATCCAACAAGGCTCTGCCGGCA
ACGTTTTGGATTTGGAATAAGGGAAATTTGTTTCTCGAGACAGCCGTCTGGCCGCAACTGCGATTGCTTTACAAG
GAAAATGTCGAGCCCCAGCTGGTGCGCATTGGAGAACGCCTCGGGCGGTACAAAAACAAGGCTCAATCCAAAGTA
CTGCAGCAAAGCGGGTCCCCCAAGACGGCTGCGTCGTCTAGCGAGCCTACACAATCACACACGACGCCGAGCTCC
TCTACAGTCTCCGAGAGCGTCGCGCCCGATTTTGACGTCGATGGCCCGGACTTTGAAGGCTCTAGCCCCAAATAC
CTCCATCCAGTGAAGGCTCCCACGCCCAGAGAAAACGAGAACGAGATGGGCCGGAACGTTCGCGAAATGGTCACG
CATGACCTAGAAACTTGGCAGGAGAAGTTCATGAGCCAGGCCGAAGAGAAGGCACACGAAATTGAAGACCGTGTC
GACGCGATTGCTCAGCGCAGCATTGAAATGCATCTCTTCACAACGGGGAGACAGCTTCTGGGGCAACTCAACTCG
ACAGCCGAGTCCGAAGTGGACCAACTGAAGCGGACGATTGTCTCCATCGTCAAGGAGAACCCTGCGAATGCACAG
GAAAGTGCCATTGCAGCCGTTCGATCGGCAGGCATCGCTATCAAGAACAGCGCTCAGGCGATTCGCGAATGGCGG
GAGAATTTCGACGCTCAACTCAAGACAACTGTCAATAACGACGTCGAGGAGTACTTTGATATCCTTGACGAGACC
AGGAGCCTTGCCTTGCAGAAGATTGGCATGAAATGGGCCTGGACCAACGGAATCTCATACCACGACTGGGCCAAA
TATCACGAGCTCAAAAATGCACTTGGGCAGTTGACGAATGAACTGAGAGAACTAGTTGTCACTCATCCCGGTTTG
ATCGAGGCTCAAGATGCCTCAGCAATGGTCGAGACGCAGGCCATGACGATTGCCGCCGGCGCCGCCCAGGAACTC
TCCCGCTTGAAGGAGGTTGCCCGCTGGAAGCTTTTGGCCCGCGATACGACCGATAGCTTCGATTTCGAGTCGATG
AAGTCGGCGGCCGAGGCTGCACAGACGCATTCAGATGGCTTATCAGATCAATCTGAAGAGCCAAACGATGCTCTT
GTCGGCATCTCGCCAGTCATTGGAATTTTCGACTCCGCCGATGGAGCGACGTCGAAGCCTGAGGAATTAGTCTCG
GAACAGGCCGAGTTGAGCAGCAGCGATACAAAAGCAACCTCGGCCGCGAGCATGTCTCATGGAAGAGCAGATGAT
GTCGAGACGGATATTACCGACTCATCGGGAGAAAGCCGGCAGGCCGGGCGTGACGGCTTCGACGACGAGAAGGTG
AAGTCAAAAGTGGCGTTCGGCGCCGCCGCTCAGGAGGTTCCCGACCGCCGTCCGATCTTGGACGAGGTCGGTGAC
TCCGACCTTTATGCCGATGCTACGTCCGCCGCCCAAGCTGCGTACTCGAGCGCCTTTTCTGCAGCGTCGGAACGG
TATAGTAGCGCGTTGTCTGTCGTTTCCGCACAGGTTTATGGCACGCCAAAGCCCGTTCATGAGCAGCTCATGGCT
TCCGTCTCGGCCGCCTACGGCAGCGCCGTCGCGGCGGCCAGCCAGAGGCTTGACGGGGCCGTCAGCGCCGCCTCA
CGCGGGGCATACGGGACGCCGACGCCGACCAGCGGGCTCGGCTCCCTAAACTGGGAAAAGGTCGAGTCAATGGCG
GCCCAGCGGCTCAATGAGGGCCGGCTCTGGGCCGAGGTGCAGTATCAAAGCGCTCTGATGGCTCTCGGAGTCGCG
ACACCGACGCCATCGGCCGACAACGCGGTTGAAAAGGCCAAGTTTCGCTACTACGCCGGCCTCGGCATCGCGCAG
GACCGGTACACGAGCTTCCTTGCCGCTGCTTCGTTGGCCTGGTCGTCGGTCACGGCGACGCCGACACCCACCGAC
CTACGGGGATCGGCCTCGTGGGCGGCGTCTGCGGCGAGCGCATCAGCCTCGTCTGTCGCGCAAGCTGCGGGCTCG
GCGGCACAGGCGGCCGGGTCTGCTGCTCAGTCTGCCTATTCGGCCGCGACCGAGAGCGTCGCCTCTGTGGCGCGT
GCTGCTGACGACTCCCTGTCGTCTGTCGCGGACGCCGCGAGCGAGCAGGTGTCCATTGCAGCAGTCGCCATCGCC
GGCACCTGGGAGAAGGTGCTGTTGGAGCTGAGCGCCCAGATATACGCCGAGCCGACAGCCATTGGATGGGGCGAT
CGACTGCTGGACGGCGCCAGCTCTTGCGCGTCTGCCGCGACCGAGACTGCCACGGAGAAGGCAGCGGCAGTCACC
GACGCGGCACGAAGCGCTGCCGATGCGGCCTCGGCGCAAGCCGCCCGGCAATTTGACGCCGTTCACGGCATCGTG
TCGGAGCTCGTGAGCGGCAGAGAACCGGCGTACAGCGAGAGCGTGCTCTCCCGACTGAGCGCCGCCTATGCTACA
GCCTCCGCCAACGTCGGCAGCCTTGCGAGCCAGGCCAGTGCCTCGGCGGCGTCGGTGGGAGAGAGACTCGGGGTC
GCGGCCAGTCATGCCACTGAGGCCGTCAAGGAGTCGGTTCAGCAGGGGAAGGATGAATTGTAG
Gene >Ophcf2|06937
ATGCTCGACTCTACGAGCGCCTGGCTCGTCGATGGCAGTCGCACCGCCAACGGCAAACTGAACGGAAAGCCCAGG
AGCTGGACCAGGAAGGCCAAGATACGCCGTGGCTTCTTCTCCCGGGCTCTCAGCCTCGTTGCCAGGTGCGTGCGC
CCGCCTCTCTTCTTATGTCGAGTCTGACCATCACCAGGTTGACCATCTGGTCGATTATTCTGACTGTGCTATTCC
GCTGTCCCTCTTCCCTCGAAGCGTGCGACGAGACGTCACCCCTCATCTGCAGTCACTACTTCCGAGCCAAGGCTA
CAGTCGCTCCTCGTCTCCAACCGTACTATGAACGCTATGCATCGTCATATGTACATGTCGTCAAGCCTTACTACC
AAGCCGTTGACAGCCACATCCTGACGCCAACTCGCGTGTATGCCGTGCGTTATGGGGCTCCTTGGGTTAACAAGG
CCCGCGCCCGTGCCTGGTCTCAGTGGGAAGTCAACGGCCAGCCCCGGCTGACACAGCTGCAAGACTTGACGGCGG
CCCGTTACGATCAATCCATCGCGCCTCATGTCGCTCGGGCGGGTCGCGCCGTCAAGCCATATTATCGGATCGCCC
GAGCCAACCTGCTGCAGCTCTATTACAAGTACGCCATGCCCGGCTACGAATTTATTCATCCACACGCGGCACGAA
GCTACGCCGTCGCTCGCAACTTCACATCCAACAAGGCTCTGCCGGCAACGTTTTGGATTTGGAATAAGGGAAATT
TGTTTCTCGAGACAGCCGTCTGGCCGCAACTGCGATTGCTTTACAAGGAAAATGTCGAGCCCCAGCTGGTGCGCA
TTGGAGAACGCCTCGGGCGGTACAAAAACAAGGCTCAATCCAAAGTACTGCAGCAAAGCGGGTAAGCACTGGACC
TGCCCTACACTCGTTGCTGGATTTGACTTGCTCATGGTGCTCTTTTCAGGTCCCCCAAGACGGCTGCGTCGTCTA
GCGAGCCTACACAATCACACACGACGCCGAGCTCCTCTACAGTCTCCGAGAGCGTCGCGCCCGATTTTGACGTCG
ATGGCCCGGACTTTGAAGGCTCTAGCCCCAAATACCTCCATCCAGTGAAGGCTCCCACGCCCAGAGAAAACGAGA
ACGAGATGGGCCGGAACGTTCGCGAAATGGTCACGCATGACCTAGAAACTTGGCAGGAGAAGTTCATGAGCCAGG
CCGAAGAGAAGGCACACGAAATTGAAGACCGTGTCGACGCGATTGCTCAGCGCAGCATTGAAATGCATCTCTTCA
CAACGGGGAGACAGCTTCTGGGGCAACTCAACTCGACAGCCGAGTCCGAAGTGGACCAACTGAAGCGGACGATTG
TCTCCATCGTCAAGGAGAACCCTGCGAATGCACAGGAAAGTGCCATTGCAGCCGTTCGATCGGCAGGCATCGCTA
TCAAGAACAGCGCTCAGGCGATTCGCGAATGGCGGGAGAATTTCGACGCTCAACTCAAGACAACTGTCAATAACG
ACGTCGAGGAGTACTTTGATATCCTTGACGAGACCAGGAGCCTTGCCTTGCAGAAGATTGGCATGAAATGGGCCT
GGACCAACGGAATCTCATACCACGACTGGGCCAAATATCACGAGCTCAAAAATGCACTTGGGCAGTTGACGAATG
AACTGAGAGAACTAGTTGTCACTCATCCCGGTTTGATCGAGGCTCAAGATGCCTCAGCAATGGTCGAGACGCAGG
CCATGACGATTGCCGCCGGCGCCGCCCAGGAACTCTCCCGCTTGAAGGAGGTTGCCCGCTGGAAGCTTTTGGCCC
GCGATACGACCGATAGCTTCGATTTCGAGTCGATGAAGTCGGCGGCCGAGGCTGCACAGACGCATTCAGATGGCT
TATCAGGTGCGTTGGTTATCTTGATGTCTGTGTGTGACTGGTCGACTGATGGGTTTTCAAGATCAATCTGAAGAG
CCAAACGATGCTCTTGTCGGCATCTCGCCAGTCATTGGAATTTTCGACTCCGCCGATGGAGCGACGTCGAAGCCT
GAGGAATTAGTCTCGGAACAGGCCGAGTTGAGCAGCAGCGATACAAAAGCAACCTCGGCCGCGAGCATGTCTCAT
GGAAGAGCAGATGATGTCGAGACGGATATTACCGGTTGGTCTCAATCTACCACTTGTGCAATGTCGGCTAACGGC
GTCAGACTCATCGGGAGAAAGCCGGCAGGCCGGGCGTGACGGCTTCGACGACGAGAAGGTGAAGTCAAAAGTGGC
GTTCGGCGCCGCCGCTCAGGAGGTTCCCGACCGCCGTCCGATCTTGGACGAGGTCGGTGACTCCGACCTTTATGC
CGATGCTACGTCCGCCGCCCAAGCTGCGTACTCGAGCGCCTTTTCTGCAGCGTCGGAACGGTATAGTAGCGCGTT
GTCTGTCGTTTCCGCACAGGTTTATGGCACGCCAAAGCCCGTTCATGAGCAGCTCATGGCTTCCGTCTCGGCCGC
CTACGGCAGCGCCGTCGCGGCGGCCAGCCAGAGGCTTGACGGGGCCGTCAGCGCCGCCTCACGCGGGGCATACGG
GACGCCGACGCCGACCAGCGGGCTCGGCTCCCTAAACTGGGAAAAGGTCGAGTCAATGGCGGCCCAGCGGCTCAA
TGAGGGCCGGCTCTGGGCCGAGGTGCAGTATCAAAGCGCTCTGATGGCTCTCGGAGTCGCGACACCGACGCCATC
GGCCGACAACGCGGTTGAAAAGGCCAAGTTTCGCTACTACGCCGGCCTCGGCATCGCGCAGGACCGGTACACGAG
CTTCCTTGCCGCTGCTTCGTTGGCCTGGTCGTCGGTCACGGCGACGCCGACACCCACCGACCTACGGGGATCGGC
CTCGTGGGCGGCGTCTGCGGCGAGCGCATCAGCCTCGTCTGTCGCGCAAGCTGCGGGCTCGGCGGCACAGGCGGC
CGGGTCTGCTGCTCAGTCTGCCTATTCGGCCGCGACCGAGAGCGTCGCCTCTGTGGCGCGTGCTGCTGACGACTC
CCTGTCGTCTGTCGCGGACGCCGCGAGCGAGCAGGTGTCCATTGCAGCAGTCGCCATCGCCGGCACCTGGGAGAA
GGTGCTGTTGGAGCTGAGCGCCCAGATATACGCCGAGCCGACAGCCATTGGATGGGGCGATCGACTGCTGGACGG
CGCCAGCTCTTGCGCGTCTGCCGCGACCGAGACTGCCACGGAGAAGGCAGCGGCAGTCACCGACGCGGCACGAAG
CGCTGCCGATGCGGCCTCGGCGCAAGCCGCCCGGCAATTTGACGCCGTTCACGGCATCGTGTCGGAGCTCGTGAG
CGGCAGAGAACCGGCGTACAGCGAGAGCGTGCTCTCCCGACTGAGCGCCGCCTATGCTACAGCCTCCGCCAACGT
CGGCAGCCTTGCGAGCCAGGCCAGTGCCTCGGCGGCGTCGGTGGGAGAGAGACTCGGGGTCGCGGCCAGTCATGC
CACTGAGGCCGTCAAGGAGTCGGTTCAGCAGGGGAAGGATGAATTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail