Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06933
Gene name
Locationscaffold_08:1432632..1437042
Strand-
Gene length (bp)4410
Transcript length (bp)3237
Coding sequence length (bp)3237
Protein length (aa) 1079

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00199 Catalase Catalase 3.2E-168 40 427
PF03462 PCRF PCRF domain 1.2E-40 716 893
PF00472 RF-1 RF-1 domain 6.0E-34 916 1025
PF06628 Catalase-rel Catalase-related immune-responsive 2.5E-17 455 518
PF01965 DJ-1_PfpI DJ-1/PfpI family 5.3E-10 553 660
PF18011 Catalase_C C-terminal domain found in long catalases 1.6E-08 552 663

GO

GO Term Description Terminal node
GO:0003747 translation release factor activity Yes
GO:0004096 catalase activity Yes
GO:0020037 heme binding Yes
GO:0006415 translational termination Yes
GO:0016684 oxidoreductase activity, acting on peroxide as acceptor No
GO:0097159 organic cyclic compound binding No
GO:0022411 cellular component disassembly No
GO:0009987 cellular process No
GO:0003676 nucleic acid binding No
GO:0046906 tetrapyrrole binding No
GO:1901363 heterocyclic compound binding No
GO:0032984 protein-containing complex disassembly No
GO:0071840 cellular component organization or biogenesis No
GO:0016209 antioxidant activity No
GO:0005488 binding No
GO:0016491 oxidoreductase activity No
GO:0004601 peroxidase activity No
GO:0003824 catalytic activity No
GO:0043933 protein-containing complex organization No
GO:0003674 molecular_function No
GO:0045182 translation regulator activity No
GO:0008079 translation termination factor activity No
GO:0090079 translation regulator activity, nucleic acid binding No
GO:0016043 cellular component organization No
GO:0008135 translation factor activity, RNA binding No
GO:0008150 biological_process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.3116 0.2082 0.0564 0.0251 0.8341 0.2301 0.067 0.0726 0.0499 0.0896

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup68
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|371
Ophiocordyceps australis 1348a (Ghana) OphauG2|3843
Ophiocordyceps australis 1348a (Ghana) OphauG2|7342
Ophiocordyceps australis map64 (Brazil) OphauB2|2376
Ophiocordyceps australis map64 (Brazil) OphauB2|5685
Ophiocordyceps camponoti-floridani Ophcf2|06554
Ophiocordyceps camponoti-floridani Ophcf2|06933 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2887
Ophiocordyceps camponoti-rufipedis Ophun1|6205
Ophiocordyceps kimflemingae Ophio5|2647
Ophiocordyceps kimflemingae Ophio5|3736
Ophiocordyceps subramaniannii Hirsu2|11160
Ophiocordyceps subramaniannii Hirsu2|2168
Ophiocordyceps subramaniannii Hirsu2|2204
Ophiocordyceps subramaniannii Hirsu2|8801

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06933
MAHLIPESIKHKVSGTSERKSSHLQLAGNLVEPSANDRLTTDFGTRQSNTDDWLRVNSKDQLGPSLLEDSFGREK
IHRFDHERIPERVVHARGAGAFGTFRLFESAHDVTHAAVLTDTSRETPVFVRFSTVLGSRGSADTVRDVRGFAVK
MYTNEGNWDIVGNNIPVFFIQDAMKFPDLIHAGKPEPGLEIPQAQSAHNNFWDFAFLHSEATHMFMWAMSDRGIP
RSFRMMQGFGVNTYTLVNAAGERSFVKFHFTPDLGVASLVWDEALKLCGQDPDFHRKDLAEAIDNGHYPRWRFGI
QTIPESREHEFDFDILDATKLWPEDKVPIRYIGQLELNRNPDEYFTQTEQVAFCTSHVVPGIGFSDDPLLQGRNF
SYFDTQISRIGINWQELPINKPLCPVMNFNRDGAMRHTISKGRVNYWPNRFEALPPATEKEGGYVDYPAKVMGIK
ERAKSDKFKEHLSQAQLFYNSMSEHEKAHIQAALSFELDHCNDPIVYERMTQRLADIDFNLAKAVANQVAGKLPD
AGKKNPGHKASGLSQTDFMPKEPTVVTRRIAIIIADGYDPIAFNAMQASLKAVGATPIVIAPRRSTISAAGEGAS
VMPDHHLEGQRSTMFDALFLPGGEKSVATLMKSGRAIHWVREAFGHLKTIAATGEAVALVEKALQSCVRTVRRVR
FITNDATSSSLAPSIILRARGMSDEYFDLKKKLETSFDAARAKRAGELQRVATALRAWDESRNAMTELEAMARDP
LQDKDLAAIARDELDTEKSKIETLERNLSVSLTPRHPFADLPCMIEFRPGPGGLECRYFADTLFNMYKGFCTRRG
LRFSVVKYELSDSGSNSTLGELPLLEAVLEVQDSGAYDMFRGEAGMHRVQRIPGNDADQRVHTSAAAIWVLPSSP
KDGSVGSADSNDPKSDFYIDPSEVKVEAMRAGGAGGQHVNKTESAIRLTHMPSGIIVSMQDHRSQQRNREQAWQV
LRSRIASQRVEQREAEAARLRSSILAAGQITRGNKIRTYNYNQDRCSDHRAGIDVHNLPDVLQGGETLDRVMEAA
REWLVDVEIRRLTAEELAKQAQRGRARA*
Coding >Ophcf2|06933
ATGGCGCACCTTATCCCAGAGTCAATCAAGCACAAAGTCTCGGGCACCTCCGAGCGAAAGTCGAGCCACTTGCAG
CTGGCGGGCAACTTGGTCGAACCCAGCGCCAATGATCGGCTGACTACCGATTTTGGCACGAGGCAGAGCAACACG
GACGACTGGCTGCGGGTAAACAGCAAAGACCAACTCGGCCCTTCTCTCCTCGAGGATAGCTTTGGTCGCGAAAAG
ATCCATCGCTTTGATCACGAACGAATCCCAGAACGTGTGGTGCATGCTCGCGGGGCAGGCGCATTTGGCACGTTC
CGTCTTTTCGAATCTGCCCATGATGTCACGCACGCCGCTGTGCTGACGGACACGAGCCGAGAGACGCCGGTCTTT
GTCCGCTTTTCCACTGTTCTCGGTAGCAGAGGATCGGCGGATACTGTACGAGACGTCCGTGGCTTCGCCGTCAAG
ATGTATACCAATGAGGGCAACTGGGACATTGTCGGCAATAATATTCCTGTCTTTTTCATCCAGGACGCGATGAAA
TTCCCAGATCTGATCCACGCGGGCAAGCCAGAGCCTGGCCTTGAGATACCACAAGCACAAAGCGCTCACAACAAT
TTTTGGGACTTTGCTTTCCTTCATTCGGAAGCGACGCACATGTTCATGTGGGCTATGTCGGATCGTGGAATTCCT
CGCAGTTTTCGGATGATGCAGGGCTTCGGCGTCAATACATACACTCTCGTTAATGCAGCCGGCGAACGGAGCTTT
GTCAAGTTTCACTTTACACCCGATCTGGGCGTCGCATCTCTTGTTTGGGACGAGGCTCTCAAACTGTGTGGACAG
GATCCAGACTTTCACCGAAAGGACTTGGCAGAAGCAATCGACAACGGCCACTACCCCCGTTGGCGTTTCGGCATA
CAGACCATCCCCGAGTCTCGTGAGCACGAGTTTGACTTTGACATTCTCGACGCCACCAAGCTATGGCCCGAGGAC
AAGGTGCCCATCCGGTATATCGGTCAGCTCGAGCTGAATCGAAACCCGGATGAGTACTTCACGCAGACTGAGCAA
GTGGCCTTTTGCACTAGCCACGTCGTGCCAGGCATTGGATTTTCGGACGATCCTCTATTGCAAGGGCGCAACTTC
AGCTACTTCGATACTCAAATTTCCAGGATTGGCATCAACTGGCAGGAGCTTCCCATCAACAAGCCCCTTTGCCCC
GTTATGAATTTTAATCGCGATGGAGCTATGCGCCATACAATCAGCAAGGGAAGGGTCAACTATTGGCCAAACCGA
TTCGAGGCTCTTCCGCCGGCCACAGAGAAGGAAGGGGGTTATGTCGATTATCCGGCCAAGGTGATGGGGATCAAG
GAGCGGGCAAAGAGCGACAAATTCAAGGAGCACTTGTCTCAGGCACAGCTCTTTTACAACTCAATGTCGGAACAC
GAGAAAGCTCACATCCAGGCCGCACTGTCGTTCGAATTAGACCATTGCAATGACCCGATTGTTTACGAGCGCATG
ACGCAGCGTCTGGCTGACATCGATTTCAATCTGGCCAAAGCTGTCGCAAATCAGGTCGCTGGAAAGCTACCAGAC
GCCGGCAAGAAGAACCCTGGACACAAAGCAAGTGGGTTGAGTCAAACCGATTTCATGCCCAAGGAGCCGACTGTT
GTGACTCGTCGCATCGCCATCATCATCGCAGATGGCTACGACCCCATCGCTTTCAACGCCATGCAGGCGTCTCTC
AAAGCCGTTGGAGCCACACCTATCGTCATCGCCCCACGCCGATCTACAATCTCTGCTGCGGGAGAAGGGGCCTCT
GTGATGCCCGATCACCATCTTGAGGGTCAACGCAGCACCATGTTCGACGCGCTTTTCCTCCCCGGAGGCGAGAAA
TCCGTCGCTACCCTAATGAAGAGCGGTCGGGCAATCCATTGGGTGCGCGAAGCGTTTGGACACCTCAAGACTATA
GCTGCTACGGGAGAAGCGGTCGCGCTTGTTGAGAAAGCTCTTCAGAGCTGCGTCAGGACTGTGCGCCGCGTTCGC
TTCATCACCAACGACGCGACGTCGAGCTCCCTCGCGCCCAGCATTATCCTCCGCGCCAGAGGCATGTCGGACGAA
TACTTCGATCTGAAGAAGAAGCTGGAGACGTCGTTCGACGCCGCTCGGGCTAAACGTGCGGGGGAGCTGCAGCGG
GTCGCCACGGCGCTGCGGGCATGGGACGAGAGTCGCAACGCCATGACGGAGCTCGAGGCCATGGCGCGGGACCCT
TTACAGGACAAGGATCTCGCCGCCATCGCCCGCGACGAGCTGGATACGGAAAAGTCCAAGATCGAGACGCTCGAA
CGGAACTTGTCGGTCAGCCTGACGCCCCGTCACCCCTTCGCCGACCTCCCCTGCATGATCGAATTTCGGCCCGGC
CCTGGCGGCCTCGAGTGCCGTTACTTTGCCGACACGCTCTTCAATATGTATAAGGGCTTCTGTACACGCAGGGGC
TTGCGCTTCAGCGTCGTCAAGTATGAATTGTCCGACTCAGGCAGCAATTCAACCCTGGGCGAGCTTCCGCTACTA
GAAGCCGTCCTCGAGGTGCAGGACTCGGGAGCGTACGACATGTTTCGCGGCGAGGCCGGCATGCACCGCGTTCAA
CGAATTCCCGGTAATGACGCCGATCAACGCGTACACACGAGCGCTGCCGCCATCTGGGTGCTCCCCTCCTCACCG
AAGGACGGTAGCGTGGGAAGCGCTGACTCGAACGACCCTAAAAGCGACTTCTACATCGATCCCAGCGAGGTCAAA
GTCGAGGCGATGCGCGCGGGTGGCGCTGGCGGCCAGCACGTCAACAAGACGGAGTCGGCAATCCGGCTGACGCAC
ATGCCCTCGGGCATCATCGTCTCGATGCAGGATCATCGCTCGCAGCAGCGTAACCGCGAGCAAGCGTGGCAGGTG
CTCCGCTCTCGTATCGCCAGTCAACGCGTGGAGCAACGTGAGGCCGAGGCGGCGCGTCTGCGGTCCAGCATCCTG
GCCGCGGGGCAGATTACGCGGGGCAACAAGATCCGGACCTACAACTACAACCAAGACCGATGCTCCGATCACCGC
GCCGGCATCGACGTGCACAACTTGCCCGATGTCCTACAAGGGGGCGAGACGCTAGATCGTGTCATGGAAGCGGCC
AGAGAGTGGCTAGTTGACGTCGAAATTCGGAGACTAACAGCTGAGGAGCTGGCAAAGCAGGCACAAAGGGGCCGA
GCGCGGGCCTGA
Transcript >Ophcf2|06933
ATGGCGCACCTTATCCCAGAGTCAATCAAGCACAAAGTCTCGGGCACCTCCGAGCGAAAGTCGAGCCACTTGCAG
CTGGCGGGCAACTTGGTCGAACCCAGCGCCAATGATCGGCTGACTACCGATTTTGGCACGAGGCAGAGCAACACG
GACGACTGGCTGCGGGTAAACAGCAAAGACCAACTCGGCCCTTCTCTCCTCGAGGATAGCTTTGGTCGCGAAAAG
ATCCATCGCTTTGATCACGAACGAATCCCAGAACGTGTGGTGCATGCTCGCGGGGCAGGCGCATTTGGCACGTTC
CGTCTTTTCGAATCTGCCCATGATGTCACGCACGCCGCTGTGCTGACGGACACGAGCCGAGAGACGCCGGTCTTT
GTCCGCTTTTCCACTGTTCTCGGTAGCAGAGGATCGGCGGATACTGTACGAGACGTCCGTGGCTTCGCCGTCAAG
ATGTATACCAATGAGGGCAACTGGGACATTGTCGGCAATAATATTCCTGTCTTTTTCATCCAGGACGCGATGAAA
TTCCCAGATCTGATCCACGCGGGCAAGCCAGAGCCTGGCCTTGAGATACCACAAGCACAAAGCGCTCACAACAAT
TTTTGGGACTTTGCTTTCCTTCATTCGGAAGCGACGCACATGTTCATGTGGGCTATGTCGGATCGTGGAATTCCT
CGCAGTTTTCGGATGATGCAGGGCTTCGGCGTCAATACATACACTCTCGTTAATGCAGCCGGCGAACGGAGCTTT
GTCAAGTTTCACTTTACACCCGATCTGGGCGTCGCATCTCTTGTTTGGGACGAGGCTCTCAAACTGTGTGGACAG
GATCCAGACTTTCACCGAAAGGACTTGGCAGAAGCAATCGACAACGGCCACTACCCCCGTTGGCGTTTCGGCATA
CAGACCATCCCCGAGTCTCGTGAGCACGAGTTTGACTTTGACATTCTCGACGCCACCAAGCTATGGCCCGAGGAC
AAGGTGCCCATCCGGTATATCGGTCAGCTCGAGCTGAATCGAAACCCGGATGAGTACTTCACGCAGACTGAGCAA
GTGGCCTTTTGCACTAGCCACGTCGTGCCAGGCATTGGATTTTCGGACGATCCTCTATTGCAAGGGCGCAACTTC
AGCTACTTCGATACTCAAATTTCCAGGATTGGCATCAACTGGCAGGAGCTTCCCATCAACAAGCCCCTTTGCCCC
GTTATGAATTTTAATCGCGATGGAGCTATGCGCCATACAATCAGCAAGGGAAGGGTCAACTATTGGCCAAACCGA
TTCGAGGCTCTTCCGCCGGCCACAGAGAAGGAAGGGGGTTATGTCGATTATCCGGCCAAGGTGATGGGGATCAAG
GAGCGGGCAAAGAGCGACAAATTCAAGGAGCACTTGTCTCAGGCACAGCTCTTTTACAACTCAATGTCGGAACAC
GAGAAAGCTCACATCCAGGCCGCACTGTCGTTCGAATTAGACCATTGCAATGACCCGATTGTTTACGAGCGCATG
ACGCAGCGTCTGGCTGACATCGATTTCAATCTGGCCAAAGCTGTCGCAAATCAGGTCGCTGGAAAGCTACCAGAC
GCCGGCAAGAAGAACCCTGGACACAAAGCAAGTGGGTTGAGTCAAACCGATTTCATGCCCAAGGAGCCGACTGTT
GTGACTCGTCGCATCGCCATCATCATCGCAGATGGCTACGACCCCATCGCTTTCAACGCCATGCAGGCGTCTCTC
AAAGCCGTTGGAGCCACACCTATCGTCATCGCCCCACGCCGATCTACAATCTCTGCTGCGGGAGAAGGGGCCTCT
GTGATGCCCGATCACCATCTTGAGGGTCAACGCAGCACCATGTTCGACGCGCTTTTCCTCCCCGGAGGCGAGAAA
TCCGTCGCTACCCTAATGAAGAGCGGTCGGGCAATCCATTGGGTGCGCGAAGCGTTTGGACACCTCAAGACTATA
GCTGCTACGGGAGAAGCGGTCGCGCTTGTTGAGAAAGCTCTTCAGAGCTGCGTCAGGACTGTGCGCCGCGTTCGC
TTCATCACCAACGACGCGACGTCGAGCTCCCTCGCGCCCAGCATTATCCTCCGCGCCAGAGGCATGTCGGACGAA
TACTTCGATCTGAAGAAGAAGCTGGAGACGTCGTTCGACGCCGCTCGGGCTAAACGTGCGGGGGAGCTGCAGCGG
GTCGCCACGGCGCTGCGGGCATGGGACGAGAGTCGCAACGCCATGACGGAGCTCGAGGCCATGGCGCGGGACCCT
TTACAGGACAAGGATCTCGCCGCCATCGCCCGCGACGAGCTGGATACGGAAAAGTCCAAGATCGAGACGCTCGAA
CGGAACTTGTCGGTCAGCCTGACGCCCCGTCACCCCTTCGCCGACCTCCCCTGCATGATCGAATTTCGGCCCGGC
CCTGGCGGCCTCGAGTGCCGTTACTTTGCCGACACGCTCTTCAATATGTATAAGGGCTTCTGTACACGCAGGGGC
TTGCGCTTCAGCGTCGTCAAGTATGAATTGTCCGACTCAGGCAGCAATTCAACCCTGGGCGAGCTTCCGCTACTA
GAAGCCGTCCTCGAGGTGCAGGACTCGGGAGCGTACGACATGTTTCGCGGCGAGGCCGGCATGCACCGCGTTCAA
CGAATTCCCGGTAATGACGCCGATCAACGCGTACACACGAGCGCTGCCGCCATCTGGGTGCTCCCCTCCTCACCG
AAGGACGGTAGCGTGGGAAGCGCTGACTCGAACGACCCTAAAAGCGACTTCTACATCGATCCCAGCGAGGTCAAA
GTCGAGGCGATGCGCGCGGGTGGCGCTGGCGGCCAGCACGTCAACAAGACGGAGTCGGCAATCCGGCTGACGCAC
ATGCCCTCGGGCATCATCGTCTCGATGCAGGATCATCGCTCGCAGCAGCGTAACCGCGAGCAAGCGTGGCAGGTG
CTCCGCTCTCGTATCGCCAGTCAACGCGTGGAGCAACGTGAGGCCGAGGCGGCGCGTCTGCGGTCCAGCATCCTG
GCCGCGGGGCAGATTACGCGGGGCAACAAGATCCGGACCTACAACTACAACCAAGACCGATGCTCCGATCACCGC
GCCGGCATCGACGTGCACAACTTGCCCGATGTCCTACAAGGGGGCGAGACGCTAGATCGTGTCATGGAAGCGGCC
AGAGAGTGGCTAGTTGACGTCGAAATTCGGAGACTAACAGCTGAGGAGCTGGCAAAGCAGGCACAAAGGGGCCGA
GCGCGGGCCTGA
Gene >Ophcf2|06933
ATGGCGCACCTTATCCCAGAGTCAATCAAGCACAAAGTCTCGGGCACCTCCGAGCGAAAGTCGAGCCACTTGCAG
CTGGCGGGCAACTTGGTCGAACCCAGCGCCAATGATCGGCTGACTACCGATTTTGGCACGAGGCAGAGCAACACG
GACGACTGGCTGCGGGTAAACAGCAAAGACCAACTCGGCCCTTCTCTCCTCGAGGATAGCTTTGGTCGCGAAAAG
GTCTGCCTAGCTCTCGAGGAGCTGTGCGTTGTCATCTAATACTGACTTTCCTGACTGCCAGATCCATCGCTTTGA
TCACGAACGAATCCCAGAACGTGTGGTGCATGCTCGCGGGGCAGGCGCATTTGGCACGTTCCGTCTTTTCGAATC
TGCCCATGATGTCACGCACGCCGCTGTGCTGACGGACACGAGCCGAGAGACGCCGGTCTTTGTCCGCTTTTCCAC
TGTTCTCGGTAGCAGAGGATCGGCGGATACTGTACGAGACGTCCGTGGCTTCGCCGTCAAGATGTATACCAATGA
GGGCAACTGGGACATTGTCGGCAATAATATTCCTGTCTTTTTCATCCAGGACGCGATGAAATTCCCAGATCTGAT
CCACGCGGGCAAGCCAGAGCCTGGCCTTGAGATACCACAAGCACAAAGCGCTCACAACAATTTTTGGGACTTTGC
TTTCCTTCATTCGGAAGCGACGCACATGTTCATGTGGGCTATGTCGGATCGTGGAATTCCTCGCAGTACGTGCAC
ACTCTTGGTATCCCTCGGTGATGTGGCTAGACCTCTGCTGATGCGACATGCCTCTCAGGTTTTCGGATGATGCAG
GGCTTCGGCGTCAATACATACACTCTCGTTAATGCAGCCGGCGAACGGAGCTTTGTCAAGTTTCACTTTACACCC
GATCTGGGCGTCGCATCTCTTGTTTGGGACGAGGCTCTCAAACTGTGTGGACAGGATCCAGACTTTCACCGAAAG
GACTTGGCAGAAGCAATCGACAACGGCCACTACCCCCGTTGGCGTTTCGGCATACAGACCATCCCCGAGTCTCGT
GAGCACGAGTTTGACTTTGACATTCTCGACGCCACCAAGCTATGGCCCGAGGACAAGGTGCCCATCCGGTATATC
GGTCAGCTCGAGCTGAATCGAAACCCGGATGAGTACTTCACGCAGACTGAGCAAGTGGCCTTTTGCACTAGCCAC
GTCGTGCCAGGCATTGGATTTTCGGACGATCCTCTATTGCAAGGGCGCAACTTCAGCTACTTCGATACTCAAATT
TCCAGGATTGGCATCAACTGGCAGGAGCTTCCCATCAACAAGCCCCTTTGCCCCGTTATGAATTTTAATCGCGAT
GGAGCTATGCGCCATACAATCAGCAAGGGAAGGGTCAACTATTGGCCAAACCGATTCGAGGCTCTTCCGCCGGCC
ACAGAGAAGGAAGGGGGTTATGTCGATTATCCGGCCAAGGTGATGGGGATCAAGGAGCGGGCAAAGAGCGACAAA
TTCAAGGAGCACTTGTCTCAGGCACAGCTCTTTTACAACTCAATGTCGGAACACGAGAAAGCTCACATCCAGGCC
GCACTGTCGTTCGAATTAGACCATTGCAATGACCCGATTGTTTACGAGCGCATGACGCAGCGTCTGGCTGACATC
GATTTCAATCTGGCCAAAGCTGTCGCAAATCAGGTCGCTGGAAAGCTACCAGACGCCGGCAAGAAGAACCCTGGA
CACAAAGCAAGTGGGTTGAGTCAAACCGATTTCATGCCCAAGGAGCCGACTGTTGTGACTCGTCGCATCGCCATC
ATCATCGCAGATGGCTACGACCCCATCGCTTTCAACGCCATGCAGGCGTCTCTCAAAGCCGTTGGAGCCACACCT
ATCGTCATCGCCCCACGCCGATCTACAATCTCTGCTGCGGGAGAAGGGGCCTCTGTGATGCCCGATCACCATCTT
GAGGGTCAACGCAGCACCATGTTCGACGCGCTTTTCCTCCCCGGAGGCGAGAAATCCGTCGCTACCCTAATGAAG
AGCGGTCGGGCAATCCATTGGGTGCGCGAAGCGTTTGGACACCTCAAGACTATAGCTGCTACGGGAGAAGCGGTC
GCGCTTGTTGAGAAAGCTCTTCAGGTAAAGGAGATTCACACGTCTGAAAGCGGAGAGGCTGTGGAGAGTTATGGA
GTTGTCACTCTCCGCGAAGCGAAGCCTGCCAGCCTCAAGGAAGTTGTCTCTGTCGTGAAAGGCGCAAGTGGTTTC
TTGGATAAGTTCCTTCACTCGACGAGCCAGCATCGTAACTGGCAGCGTGAGTTGGATGGCTTGAGCAGTCTTGTG
GCGTATTAGGAGAAGAAATGCGCTGTTTGCGAGACAGTGCCTGGGACATCAATTTGTATATATCGCATTCAATGC
CTCAGAAGGGTGGTCTGGACAAAACTGGTACTAATTTCTTCGCTACTAGAACCATGAAGCTCGTCCATGACGACG
CGATTTAAATCCGTAAGTTCCTTCACAAAATTTTTATTGGTGTATTCAAATAAAAAAAAATTTCAACCTACTACG
AGAGAGAATGACTCCGTGCCCGCTCTAGTCAGAAGCCGACGATTACTTCGTGAGGGGCCTCCTGGTCATGGGTTA
ACCTCATATTGAGCATTAGGCAAAAACAAGAAGACTGCCTCTATAGCTCAGTGGTAGAGCGTTACACTTGTACTC
TACCTCAGCGATGTAAAGGCCTGTGGTTCGACTCCGCATGGAGGCTAGTTGTTTTTTTTGTCTTTTTCGTTCTCT
ATTTAAATTATCGCCGGCATTTCCCGGGTTCTTTTTTTCGACGAATATTCCAATGATCAATCATTACTAAATACC
TACTACATTCAGGTTTACTACATACATACATATACACAGGGCCCTATGTATGTACAGCGGGTTACCACTCAATCC
GAGCTTAGAGCTCACACTCGGACTACGGCTGGTCGCCTGTGGGCCGTATCACAGAGACGCAAATTATCGAGTCAC
GTGGGTGCAGCCAACGACTTGCCAGGCACCTACATCTTAGCATTTATCTTGTCTTGTCGTCGTCGATGATCCCCG
TTTTCCTGCAGCAGCATGCTCTCTACAGCTACGTGGCTCTGCCAGAGCTGCGTCAGGACTGTGCGCCGCGTTCGC
TTCATCACCAACGGTAGGTATATTAATTGATACCCGAGCACTGCAGCTAAATCAACTCCAGACGCGACGTCGAGC
TCCCTCGCGCCCAGCATTATCCTCCGCGCCAGAGGCATGTCGGACGAATACTTCGATCTGAAGAAGAAGCTGGAG
ACGTCGTTCGACGCCGCTCGGGCTAAACGTGCGGGGGAGCTGCAGCGGGTCGCCACGGCGCTGCGGGCATGGGAC
GAGAGTCGCAACGCCATGACGGAGCTCGAGGCCATGGCGCGGGACCCTTTACAGGACAAGGATCTCGCCGCCATC
GCCCGCGACGAGCTGGATACGGAAAAGTCCAAGATCGAGACGCTCGAACGGAACTTGTCGGTCAGCCTGACGCCC
CGTCACCCCTTCGCCGACCTCCCCTGCATGATCGAATTTCGGCCCGGCCCTGGCGGCCTCGAGTGCCGTTACTTT
GCCGACACGCTCTTCAATATGTATAAGGGCTTCTGTACACGCAGGGGCTTGCGCTTCAGCGTCGTCAAGTATGAA
TTGTCCGACTCAGGCAGCAATTCAACCCTGGGCGAGCTTCCGCTACTAGAAGCCGTCCTCGAGGTGCAGGACTCG
GGAGCGTACGACATGTTTCGCGGCGAGGCCGGCATGCACCGCGTTCAACGAATTCCCGGTAATGACGCCGATCAA
CGCGTACACACGAGCGCTGCCGCCATCTGGGTGCTCCCCTCCTCACCGAAGGACGGTAGCGTGGGAAGCGCTGAC
TCGAACGACCCTAAAAGCGACTTCTACATCGATCCCAGCGAGGTCAAAGTCGAGGCGATGCGCGCGGGTGGCGCT
GGCGGCCAGCACGTCAACAAGACGGAGTCGGCAATCCGGCTGACGCACATGCCCTCGGGCATCATCGTCTCGATG
CAGGATCATCGCTCGCAGCAGCGTAACCGCGAGCAAGCGTGGCAGGTGCTCCGCTCTCGTATCGCCAGTCAACGC
GTGGAGCAACGTGAGGCCGAGGCGGCGCGTCTGCGGTCCAGCATCCTGGCCGCGGGGCAGATTACGCGGGGCAAC
AAGATCCGGACCTACAACTACAACCAAGACCGATGCTCCGATCACCGCGCCGGCATCGACGTGCACAACTTGCCC
GATGTCCTACAAGGGGGCGAGACGCTAGATCGTGTCATGGAAGCGGCCAGAGAGTGGCTAGTTGACGTCGAAATT
CGGAGACTAACAGCTGAGGAGCTGGCAAAGCAGGCACAAAGGGGCCGAGCGCGGGCCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail