Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06925
Gene name
Locationscaffold_08:1416976..1418955
Strand+
Gene length (bp)1979
Transcript length (bp)1803
Coding sequence length (bp)1803
Protein length (aa) 601

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01019 G_glu_transpept Gamma-glutamyltranspeptidase 3.3E-133 47 595

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.7429 0.2571 0.2875 0.0164 0.6128 0.2449 0.0591 0.1094 0.0342 0.1017

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3268
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4116
Ophiocordyceps australis map64 (Brazil) OphauB2|7546
Ophiocordyceps camponoti-floridani Ophcf2|06925 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1934
Ophiocordyceps kimflemingae Ophio5|2650
Ophiocordyceps subramaniannii Hirsu2|5946

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06925
MPLSVSSIYPSDASRELYRFASRRSVIHSTEGIVACSQPLAAKCGLEVLRAGGNAADAAVAVAAGLNVTEPASTG
IGGDMFILFWDAAAKKVHAINGSGRSGADCKLDVIRKDLGIPHGVGGGIPSTSAHAVTVPGAAAGWIDTVESLGS
GKLGLDEILGPAIQLAERGSPVHEEAAIFWANAESQLRAASPNFAELLKQDASAKDGVRAPQPGEVMRNPSLART
FRALVSQGKKGFYTGRVAEEIVAIVRNKGGHMSLDDLEHHLDAGREDVEAVSIKFRGQGLDDKGIKLWEHPPSGQ
GIVALMALGIIQQMQEQGKIPIFGPQDFNTAPYLHAIIEALRLAFSDAHWFVTDPGVVEVPVKGLLSDAYLAERA
KLFNPSRAARHLCHGSPNSPALQSCDTVYFAVSDAQGNAASFINSNYAGFGTGMIPRGCGFALHNRGSNFSLHAG
HPNQLAPRKRPYHTIIPAVVTNLTDGSLHSVFGVMGGFMQPQGHVQVLLGQIVGRLNPQQALDAPRVRVFVSDTD
SQGEPEWTVNVESGMPSATIDGLRELGHRVKAVVDDKTRDMFGRGQIIRYTVDDDGTPIWSAGSDMRADGAAYPA
*
Coding >Ophcf2|06925
ATGCCGCTCTCCGTATCTTCAATCTATCCTAGCGATGCTTCGCGGGAGTTATACAGATTCGCCTCTCGGCGGAGC
GTCATCCACAGCACCGAGGGCATCGTCGCCTGCTCCCAGCCGCTGGCCGCCAAGTGCGGACTCGAAGTGTTGCGT
GCTGGCGGGAACGCGGCTGACGCAGCTGTGGCAGTCGCTGCCGGCCTCAACGTAACTGAGCCCGCATCGACCGGC
ATTGGTGGCGACATGTTTATACTCTTCTGGGACGCTGCAGCCAAGAAAGTACATGCCATCAATGGCTCCGGCCGC
TCCGGCGCCGACTGCAAGCTGGACGTCATCCGTAAGGATCTCGGCATCCCGCATGGCGTCGGTGGCGGAATTCCG
TCGACGAGTGCTCACGCGGTCACGGTACCCGGAGCCGCTGCCGGTTGGATCGACACAGTCGAAAGTCTTGGGAGC
GGGAAGCTTGGGCTGGACGAGATATTGGGGCCGGCAATCCAGCTGGCAGAGCGAGGGTCTCCCGTCCACGAAGAG
GCGGCCATATTTTGGGCCAATGCCGAATCCCAGCTTCGAGCCGCTTCCCCCAACTTTGCCGAGCTGCTCAAGCAA
GATGCCAGTGCCAAGGACGGCGTCAGGGCCCCTCAGCCGGGAGAAGTGATGAGAAACCCCAGCCTGGCTCGCACG
TTTCGAGCCCTGGTCTCTCAAGGCAAGAAAGGCTTCTACACCGGACGCGTGGCCGAGGAAATCGTCGCAATCGTG
AGAAACAAGGGCGGTCATATGTCCCTCGACGATCTCGAGCACCATCTCGACGCAGGCAGAGAGGATGTCGAGGCC
GTCTCCATCAAGTTCCGCGGACAGGGACTCGACGACAAGGGCATCAAACTCTGGGAGCATCCGCCTAGTGGCCAG
GGCATCGTGGCCCTCATGGCGCTCGGCATCATTCAGCAGATGCAGGAGCAGGGCAAGATTCCCATCTTTGGCCCC
CAAGACTTCAACACGGCACCGTATCTACACGCCATCATCGAGGCTCTGCGTCTTGCCTTTTCCGACGCCCACTGG
TTCGTGACGGATCCCGGTGTCGTCGAAGTGCCTGTCAAAGGCCTCCTCTCTGACGCCTATCTGGCCGAACGGGCC
AAACTCTTCAACCCGTCCCGCGCAGCTCGTCATCTATGCCACGGGTCTCCGAACTCGCCAGCGTTACAGAGCTGC
GATACAGTCTACTTTGCCGTCTCTGATGCCCAGGGTAATGCCGCGTCTTTTATCAATTCCAACTACGCTGGCTTT
GGCACCGGCATGATTCCTCGAGGCTGTGGCTTCGCCCTTCACAACCGCGGCTCCAACTTCTCTCTTCACGCTGGG
CATCCCAACCAGCTTGCTCCTCGCAAACGACCGTATCACACCATCATCCCGGCCGTCGTCACTAATCTCACCGAC
GGCTCGCTGCACTCCGTCTTCGGAGTCATGGGCGGCTTCATGCAGCCCCAAGGTCACGTCCAGGTACTGCTGGGC
CAGATCGTTGGTCGCCTGAACCCGCAGCAGGCGCTTGACGCGCCCAGGGTACGTGTCTTCGTCTCGGACACGGAC
TCACAAGGGGAACCAGAGTGGACAGTGAATGTAGAGAGTGGCATGCCGTCCGCCACCATCGACGGCCTCAGGGAA
CTCGGACACCGAGTGAAGGCGGTAGTCGACGATAAGACGAGAGACATGTTTGGGCGCGGACAGATCATCAGATAT
ACGGTTGATGACGACGGCACGCCCATCTGGTCGGCAGGAAGTGACATGAGGGCAGATGGGGCGGCGTATCCCGCA
TAG
Transcript >Ophcf2|06925
ATGCCGCTCTCCGTATCTTCAATCTATCCTAGCGATGCTTCGCGGGAGTTATACAGATTCGCCTCTCGGCGGAGC
GTCATCCACAGCACCGAGGGCATCGTCGCCTGCTCCCAGCCGCTGGCCGCCAAGTGCGGACTCGAAGTGTTGCGT
GCTGGCGGGAACGCGGCTGACGCAGCTGTGGCAGTCGCTGCCGGCCTCAACGTAACTGAGCCCGCATCGACCGGC
ATTGGTGGCGACATGTTTATACTCTTCTGGGACGCTGCAGCCAAGAAAGTACATGCCATCAATGGCTCCGGCCGC
TCCGGCGCCGACTGCAAGCTGGACGTCATCCGTAAGGATCTCGGCATCCCGCATGGCGTCGGTGGCGGAATTCCG
TCGACGAGTGCTCACGCGGTCACGGTACCCGGAGCCGCTGCCGGTTGGATCGACACAGTCGAAAGTCTTGGGAGC
GGGAAGCTTGGGCTGGACGAGATATTGGGGCCGGCAATCCAGCTGGCAGAGCGAGGGTCTCCCGTCCACGAAGAG
GCGGCCATATTTTGGGCCAATGCCGAATCCCAGCTTCGAGCCGCTTCCCCCAACTTTGCCGAGCTGCTCAAGCAA
GATGCCAGTGCCAAGGACGGCGTCAGGGCCCCTCAGCCGGGAGAAGTGATGAGAAACCCCAGCCTGGCTCGCACG
TTTCGAGCCCTGGTCTCTCAAGGCAAGAAAGGCTTCTACACCGGACGCGTGGCCGAGGAAATCGTCGCAATCGTG
AGAAACAAGGGCGGTCATATGTCCCTCGACGATCTCGAGCACCATCTCGACGCAGGCAGAGAGGATGTCGAGGCC
GTCTCCATCAAGTTCCGCGGACAGGGACTCGACGACAAGGGCATCAAACTCTGGGAGCATCCGCCTAGTGGCCAG
GGCATCGTGGCCCTCATGGCGCTCGGCATCATTCAGCAGATGCAGGAGCAGGGCAAGATTCCCATCTTTGGCCCC
CAAGACTTCAACACGGCACCGTATCTACACGCCATCATCGAGGCTCTGCGTCTTGCCTTTTCCGACGCCCACTGG
TTCGTGACGGATCCCGGTGTCGTCGAAGTGCCTGTCAAAGGCCTCCTCTCTGACGCCTATCTGGCCGAACGGGCC
AAACTCTTCAACCCGTCCCGCGCAGCTCGTCATCTATGCCACGGGTCTCCGAACTCGCCAGCGTTACAGAGCTGC
GATACAGTCTACTTTGCCGTCTCTGATGCCCAGGGTAATGCCGCGTCTTTTATCAATTCCAACTACGCTGGCTTT
GGCACCGGCATGATTCCTCGAGGCTGTGGCTTCGCCCTTCACAACCGCGGCTCCAACTTCTCTCTTCACGCTGGG
CATCCCAACCAGCTTGCTCCTCGCAAACGACCGTATCACACCATCATCCCGGCCGTCGTCACTAATCTCACCGAC
GGCTCGCTGCACTCCGTCTTCGGAGTCATGGGCGGCTTCATGCAGCCCCAAGGTCACGTCCAGGTACTGCTGGGC
CAGATCGTTGGTCGCCTGAACCCGCAGCAGGCGCTTGACGCGCCCAGGGTACGTGTCTTCGTCTCGGACACGGAC
TCACAAGGGGAACCAGAGTGGACAGTGAATGTAGAGAGTGGCATGCCGTCCGCCACCATCGACGGCCTCAGGGAA
CTCGGACACCGAGTGAAGGCGGTAGTCGACGATAAGACGAGAGACATGTTTGGGCGCGGACAGATCATCAGATAT
ACGGTTGATGACGACGGCACGCCCATCTGGTCGGCAGGAAGTGACATGAGGGCAGATGGGGCGGCGTATCCCGCA
TAG
Gene >Ophcf2|06925
ATGCCGCTCTCCGTATCTTCAATCTATCCTAGCGATGCTTCGCGGGAGTTATACAGATTCGCCTCTCGGCGGAGC
GTCATCCACAGCACCGAGGGCATCGTCGCCTGCTCCCAGCCGCTGGCCGCCAAGTGCGGACTCGAAGTGTTGCGT
GCTGGCGGGAACGCGGCTGTGAGAAGACTTATGAGTCAAGGAGCATATGCTCGACGCATCAGTTGCTGACGATGA
CACGCAGGACGCAGCTGTGGCAGTCGGCAAGTCTGTCTGAAGATGGGATGATGCATCAAGTACTGACCAAGACGA
GGGAACAGCTGCCGGCCTCAACGTAACTGAGCCCGCATCGACCGGCATTGGTGGCGACATGTTTATACTCTTCTG
GGACGCTGCAGCCAAGAAAGTACATGCCATCAATGGCTCCGGCCGCTCCGGCGCCGACTGCAAGCTGGACGTCAT
CCGTAAGGATCTCGGCATCCCGCATGGCGTCGGTGGCGGAATTCCGTCGACGAGTGCTCACGCGGTCACGGTACC
CGGAGCCGCTGCCGGTTGGATCGACACAGTCGAAAGTCTTGGGAGCGGGAAGCTTGGGCTGGACGAGATATTGGG
GCCGGCAATCCAGCTGGCAGAGCGAGGGTCTCCCGTCCACGAAGAGGCGGCCATATTTGCAAGTGGCAGCGGCAT
CCCGTGTCCGTAGATCTCGCGTCTAACGGTATAGTCAGTGGGCCAATGCCGAATCCCAGCTTCGAGCCGCTTCCC
CCAACTTTGCCGAGCTGCTCAAGCAAGATGCCAGTGCCAAGGACGGCGTCAGGGCCCCTCAGCCGGGAGAAGTGA
TGAGAAACCCCAGCCTGGCTCGCACGTTTCGAGCCCTGGTCTCTCAAGGCAAGAAAGGCTTCTACACCGGACGCG
TGGCCGAGGAAATCGTCGCAATCGTGAGAAACAAGGGCGGTCATATGTCCCTCGACGATCTCGAGCACCATCTCG
ACGCAGGCAGAGAGGATGTCGAGGCCGTCTCCATCAAGTTCCGCGGACAGGGACTCGACGACAAGGGCATCAAAC
TCTGGGAGCATCCGCCTAGTGGCCAGGGCATCGTGGCCCTCATGGCGCTCGGCATCATTCAGCAGATGCAGGAGC
AGGGCAAGATTCCCATCTTTGGCCCCCAAGACTTCAACACGGCACCGTATCTACACGCCATCATCGAGGCTCTGC
GTCTTGCCTTTTCCGACGCCCACTGGTTCGTGACGGATCCCGGTGTCGTCGAAGTGCCTGTCAAAGGCCTCCTCT
CTGACGCCTATCTGGCCGAACGGGCCAAACTCTTCAACCCGTCCCGCGCAGCTCGTCATCTATGCCACGGGTCTC
CGAACTCGCCAGCGTTACAGAGCTGCGATACAGTCTACTTTGCCGTCTCTGATGCCCAGGGTAATGCCGCGTCTT
TTATCAATTCCAACTACGCTGGCTTTGGCACCGGCATGATTCCTCGAGGCTGTGGCTTCGCCCTTCACAACCGCG
GCTCCAACTTCTCTCTTCACGCTGGGCATCCCAACCAGCTTGCTCCTCGCAAACGACCGTATCACACCATCATCC
CGGCCGTCGTCACTAATCTCACCGACGGCTCGCTGCACTCCGTCTTCGGAGTCATGGGCGGCTTCATGCAGCCCC
AAGGTCACGTCCAGGTACTGCTGGGCCAGATCGTTGGTCGCCTGAACCCGCAGCAGGCGCTTGACGCGCCCAGGG
TACGTGTCTTCGTCTCGGACACGGACTCACAAGGGGAACCAGAGTGGACAGTGAATGTAGAGAGTGGCATGCCGT
CCGCCACCATCGACGGCCTCAGGGAACTCGGACACCGAGTGAAGGCGGTAGTCGACGATAAGACGAGAGACATGT
TTGGGCGCGGACAGATCATCAGATATACGGTTGATGACGACGGCACGCCCATCTGGTCGGCAGGAAGTGACATGA
GGGCAGATGGGGCGGCGTATCCCGCATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail